A Search Service for Abbreviation / Long Form

Abbreviation List in Life Science - LL

The following abbreviations beginning with 'LL' are found in the Allie database (>=2, order of frequency). Search for one's corresponding long forms on Allie by clicking it.


LL  ( in XML )  (4908)
  » lumbar lordosis (XML) | longissimus lumborum (XML) | lower limb (XML) | lepromatous leprosy (XML) | low light (XML) ...
LLMs  ( in XML )  (2587)
  » large language models (XML) | language models (XML) | lipid-laden macrophages (XML) | lipid-lowering medications (XML) | large-scale language models (XML) ...
LLLT  ( in XML )  (2334)
  » low-level laser therapy (XML) | low-level laser treatment (XML) | low-level laser/light therapy (XML) | low reactive-level laser therapy (XML) | low-level lasers therapy (XML) ...
LLC  ( in XML )  (1769)
  » Lewis lung carcinoma (XML) | Lewis lung cancer (XML) | lyotropic liquid crystal (XML) | lower lateral cartilage (XML) | Lake Louise criteria (XML) ...
LLOQ  ( in XML )  (1757)
  » lower limit of quantification (XML) | lower LOQ (XML) | limit of lower quantification (XML) | linearity, limit of quantification (XML) | Lower Limb Outcomes Questionnaire (XML) ...
LLD  ( in XML )  (1701)
  » leg length discrepancy (XML) | late-life depression (XML) | lower limit of detection (XML) | lipid-lowering drugs (XML) | left lateral decubitus (XML) ...
LLPS  ( in XML )  (1662)
  » liquid-liquid phase separation (XML) | low-load prolonged stretch (XML) | lower-limb paralysis simulator (XML) | LLPS-DRs (XML) | liquid-liquid phase-separated intermediate (XML) ...
LLE  ( in XML )  (1415)
  » liquid-liquid extraction (XML) | locally linear embedding (XML) | largest Lyapunov exponent (XML) | liquid-liquid equilibrium (XML) | loss of life expectancy (XML) ...
LLR  ( in XML )  (1055)
  » laparoscopic liver resection (XML) | log-likelihood ratio (XML) | long latency response (XML) | long-latency reflex (XML) | locally low-rank (XML) ...
LLINs  ( in XML )  (862)
  » long-lasting insecticidal nets (XML) | long-lasting impregnated nets (XML) | long-lasting insecticidal mosquito nets (XML) | interventions-long-lasting insecticidal nets (XML) | long-lasting insecticidal bednets impregnated with pyrethroid insecticides (XML) ...
LLL  ( in XML )  (854)
  » late lumen loss (XML) | left lower lobe (XML) | low-level laser (XML) | lower limb lymphedema (XML) | lower leg length (XML) ...
LLM  ( in XML )  (836)
  » large language model (XML) | lipid-lowering medication (XML) | leg lean mass (XML) | lipid-laden macrophages (XML) | Logic Learning Machine (XML) ...
LLS  ( in XML )  (817)
  » laser light scattering (XML) | Lake Louise Score (XML) | left lateral sectionectomy (XML) | left lateral segment (XML) | linear least squares (XML) ...
LLT  ( in XML )  (811)
  » lipid-lowering therapy (XML) | lipid layer thickness (XML) | lipid-lowering treatment (XML) | liquid-liquid transition (XML) | lower lethal temperature (XML) ...
LLO  ( in XML )  (595)
  » listeriolysin O (XML) | lipid-linked oligosaccharide (XML) | laser lift-off (XML) | Li-rich layered oxide (XML) | lateral line organ (XML) ...
LLA  ( in XML )  (566)
  » lower limb amputation (XML) | lumbar lordosis angle (XML) | lower limit of autoregulation (XML) | lumbar lordotic angle (XML) | lipid-lowering agents (XML) ...
LLN  ( in XML )  (520)
  » lower limit of normal (XML) | lateral lymph node (XML) | limit of normal (XML) | lingual lymph node (XML) | Liquid lipid nanocapsules (XML) ...
LLIF  ( in XML )  (514)
  » lateral lumbar interbody fusion (XML) | lumbar lateral interbody fusion (XML) | lateral lumbar transpsoas interbody fusion (XML) | lateral lumbar intervertebral fusion (XML) | lateral LIF (XML) ...
LLNA  ( in XML )  (453)
  » local lymph node assay (XML) | local lymph node (XML) | local lymph node assay: 5-bromo-2-deoxyuridine-flow cytometry method (XML) | local lymph node assay using 5-bromo-2-deoxyuridine (BrdU) with flow cytometry (XML) | LLNA modified by Daicel based on ATP content (XML) ...
LLETZ  ( in XML )  (308)
  » large loop excision of the transformation zone (XML) | loop excision of the cervical transformation zone (XML) | large loop excision of the TZ (XML) | Loop Electrosurgical Excision of the Transformation Zone (XML) | loop electric excision for the transformation zone (XML) ...
LLP  ( in XML )  (303)
  » long-lasting potentiation (XML) | lower limb prosthesis (XML) | lateral locking plate (XML) | Liverpool Lung Project (XML) | laparoscopic left pancreatectomy (XML) ...
LLV  ( in XML )  (268)
  » low-level viremia (XML) | lymphoid leukosis virus (XML) | lean leg volume (XML) | liver lobe volume (XML) | lower limit of vulnerability (XML) ...
LLIN  ( in XML )  (253)
  » long-lasting insecticidal net (XML) | long-lasting impregnated nets (XML) | Long lasting impregnated mosquito net (XML) | long-lasting insecticidal net mass distribution (XML) | long-lasting factory-treated insecticidal net (XML) ...
LLI  ( in XML )  (217)
  » leg length inequality (XML) | liquid-liquid interface (XML) | language-learning impairment (XML) | limiting longstanding illness (XML) | long-lived individuals (XML) ...
LLDPE  ( in XML )  (198)
  » linear low-density polyethylene (XML) | low-density polyethylene (XML) | linear low-density PE (XML) | Low-Linear Density Polyethylene (XML)
LLCs  ( in XML )  (188)
  » lyotropic liquid crystals (XML) | life-limiting conditions (XML) | large luteal cells (XML) | lamellar liquid crystals (XML) | Lewis lung cancer cells (XML) ...
LLDAS  ( in XML )  (157)
  » lupus low disease activity state (XML) | Low Lupus Disease Activity State (XML) | low lupus disease activity status (XML) | Lupus Low Disease Activity State definition (XML) | Lupus LDA State (XML) ...
LLOD  ( in XML )  (156)
  » lower limit of detection (XML) | lower detection limit (XML) | late-late onset disease (XML) | lower LOD limit (XML) | lower LOD (XML) ...
LLNM  ( in XML )  (155)
  » lateral lymph node metastasis (XML) | lateral LNM (XML) | lateral LN metastasis (XML) | LLN metastasis (XML)
LLF  ( in XML )  (153)
  » Ligustri Lucidi Fructus (XML) | lung lavage fluid (XML) | lung lining fluid (XML) | leadership learning framework (XML) | lateral lingual foramen (XML) ...
LLND  ( in XML )  (150)
  » lateral lymph node dissection (XML) | LLN dissection (XML) | laparoscopic lymph node dissection (XML) | limited lymph node dissection (XML) | lateral LND (XML) ...
LLDs  ( in XML )  (140)
  » lipid-lowering drugs (XML) | living liver donors (XML) | leg length discrepancies (XML) | long-lasting depolarizations (XML) | limb length discrepancies (XML) ...
LLQ  ( in XML )  (135)
  » lower limit of quantification (XML) | left lower quadrant (XML) | Low Luminance Questionnaire (XML) | Lake Louise Questionnaire (XML) | Lower Limb Outcome Questionnaire (XML) ...
L. lactis  ( in XML )  (132)
  » Lactococcus lactis (XML) | Lactococcus lactis subsp. lactis (XML) | Lactobacillus lactis (XML) | Lactococcuslactis subsp. cremoris (XML)
L-LTP  ( in XML )  (131)
  » late-phase long-term potentiation (XML) | late-phase LTP (XML) | late LTP (XML) | long-lasting long-term potentiation (XML) | long-lasting LTP (XML) ...
LLCT  ( in XML )  (117)
  » ligand-to-ligand charge transfer (XML) | low-lying cerebellar tonsils (XML) | low load compression testing (XML) | lung-to-lung circulation time (XML) | LLCT was the only independent predictor where VO(2peak) = 3.923-0.045 (XML) ...
L-LA  ( in XML )  (114)
  » L-lactide (XML) | L-lactic acid (XML) | linearity of the molecular weight vs (XML) | liposomes with lipoic acid (XML) | low-dose Lindera aggregata (XML) ...
LLRs  ( in XML )  (114)
  » long-latency reflexes (XML) | laparoscopic liver resections (XML) | long-leg radiographs (XML) | long-latency responses (XML) | large local reactions (XML) ...
LLs  ( in XML )  (113)
  » Landau levels (XML) | lower limbs (XML) | linear lesions (XML) | landfill leachates (XML) | lowlanders (XML) ...
LLG  ( in XML )  (101)
  » Landau-Lifshitz-Gilbert (XML) | lipid layer grade (XML) | log-likelihood gain (XML) | Leucaena leucocephala galactomannan (XML) | late lumen gain (XML) ...
LLLI  ( in XML )  (98)
  » low-level laser irradiation (XML) | La Leche League International (XML) | lower-limb length inequality (XML) | lower-left lateral incisor (XML) | lower limb lymphatic insufficiency (XML) ...
LLOQs  ( in XML )  (89)
  » lower limits of quantification (XML) | low quantification limits (XML)
L-L  ( in XML )  (85)
  » liquid-liquid (XML) | leading edge-to-leading edge (XML) | low GL (XML) | latero-lateral (XML) | low supply-low demand (XML) ...
LLMICs  ( in XML )  (79)
  » low- and lower-middle-income countries (XML) | lower middle income countries (XML)
LLPCs  ( in XML )  (77)
  » long-lived plasma cells (XML) | long-lived PCs (XML) | long-lived, bone marrow-associated plasma cells (XML) | long-lived memory plasma cells (XML) | long-lived, immunoglobulin-secreting plasma cells (XML)
LLDN  ( in XML )  (76)
  » laparoscopic live donor nephrectomy (XML) | laparoscopic LDN (XML) | left LDN (XML) | Lateral lymph node dissection (XML) | low latency deterministic network (XML) ...
LLH  ( in XML )  (70)
  » laparoscopic left hemihepatectomy (XML) | left laryngeal hemiplegia (XML) | long loops of Henle (XML) | low-level hemolysis (XML) | long-lasting hyperpolarization (XML) ...
LLTs  ( in XML )  (67)
  » lipid-lowering therapies (XML) | lipid-lowering treatments (XML) | liquid-liquid transitions (XML) | lowest level terms (XML) | lower lethal temperatures (XML) ...
LLOs  ( in XML )  (66)
  » lipid-linked oligosaccharides (XML) | Li-rich layered oxides (XML) | Lithium-rich layered oxides (XML) | Li-rich layered oxides cathodes (XML) | Lower limb orthoses (XML) ...
LLFDI  ( in XML )  (65)
  » Late-Life Function and Disability Instrument (XML) | late-life function and disability (XML) | Late-life Disability and Function Index (XML)
LLME  ( in XML )  (65)
  » liquid-liquid microextraction (XML) | L-leucyl-L-leucine methyl ester (XML) | LeuLeuOMe (XML) | Leu-Leu-O-methyl ester (XML) | LLME was applied, the sample amount was less (XML) ...
LLB  ( in XML )  (63)
  » low-level blast (XML) | long leg braces (XML) | laparoscopic lymph node biopsy (XML) | laparoscopic liver biopsy (XML) | leaderless bacteriocins (XML) ...
LLCP  ( in XML )  (62)
  » liquid-liquid critical point (XML) | lateral lamella of cribriform plate (XML) | lamella of the cribriform plate (XML) | LL critical point (XML) | LLC precursor (XML) ...
LLNs  ( in XML )  (62)
  » lateral lymph nodes (XML) | lower limits of normal (XML) | lingual lymph nodes (XML) | Lipid-like nanoparticles (XML) | Low-Power and Lossy Networks (XML) ...
LLVA  ( in XML )  (61)
  » low-luminance visual acuity (XML) | low-luminance VA (XML) | low-luminance best-corrected visual acuity (XML) | Lower limb vascular access (XML)
LLFS  ( in XML )  (61)
  » Long Life Family Study (XML) | low lung function subgroup (XML)
LLAs  ( in XML )  (58)
  » lower limb amputations (XML) | lipid-lowering agents (XML) | lower limb amputees (XML) | lower-limb amputations (XML) | lateral lenticulostriate arteries (XML) ...
LLNL  ( in XML )  (57)
  » Lawrence Livermore National Laboratory (XML)
LLPs  ( in XML )  (55)
  » long-lived proteins (XML) | long-lived particles (XML) | lipoprotein-like particles (XML) | lysozyme-like proteins (XML) | lipid layer patterns (XML) ...
LLPT  ( in XML )  (49)
  » liquid-liquid phase transition (XML) | Left Leg Proprioception Test (XML)
LLPC  ( in XML )  (46)
  » long-lived plasma cells (XML) | liquid-liquid partition chromatography (XML) | left lateral parietal cortex (XML) | local label point correction (XML) | list-level PC (XML) ...
LLIs  ( in XML )  (45)
  » long-lived individuals (XML) | Leg length inequalities (XML) | life-limiting illnesses (XML) | lower-limb injuries (XML) | language-based learning impairments (XML) ...
L-Lys  ( in XML )  (45)
  » L-lysine (XML) | L-lysine hydrochloride (XML)
L-LDH  ( in XML )  (43)
  » L-lactate dehydrogenase (XML) | LDH-like (XML) | L-lactic dehydrogenase (XML)
LLMI  ( in XML )  (42)
  » lipid-laden macrophage index (XML) | lower limit of the measuring interval (XML) | low- and lower middle-income (XML) | Left lateral mitral isthmus (XML) | lower limb strength measured by the Motricity Index (XML) ...
l-LV  ( in XML )  (40)
  » l-leucovorin (XML) | levofolinate (XML) | levofolinate calcium (XML) | levoleucovorin (XML)
LL-BFR  ( in XML )  (39)
  » Low-load blood flow restriction (XML) | low-load resistance training with blood flow restriction (XML) | low-load BFR (XML) | low-load exercise with blood-flow restriction (XML) | LL-RT with blood flow restriction (XML) ...
LLSM  ( in XML )  (39)
  » lattice light-sheet microscopy (XML) | Life Log Sharing Model (XML) | linear limited sampling model (XML) | linear-linear sire-maternal grandsire (XML) | Laparoscopic lateral suspension with mesh (XML)
LLW  ( in XML )  (37)
  » low-level radioactive waste (XML) | low level waste (XML) | Landrace-Large White (XML) | left lung weight (XML) | liquid/liquid optical waveguide (XML) ...
LLLS  ( in XML )  (36)
  » laparoscopic left lateral sectionectomy (XML) | liver left lateral section (XML) | lower-limb lengthening surgery (XML) | low-level laser stimulation (XML) | local linearized least squares (XML) ...
LLT1  ( in XML )  (34)
  » lectin-like transcript 1 (XML) | CD161-Lectin-like Transcript 1 (XML) | LLT1TC (XML)
LLDS  ( in XML )  (32)
  » Lifelines Diet Score (XML) | low liver-damage strategy (XML) | local drug delivery systems (XML) | longitude and latitude division system (XML) | laser-light diffraction spectroscopy (XML) ...
LLAR  ( in XML )  (29)
  » laparoscopic low anterior resection (XML) | MI-LAR and OLAR and between laparoscopic (XML) | laparoscopic LAR (XML) | lower level of autoregulation (XML) | low laparoscopic anterior resection (XML) ...
LLTS  ( in XML )  (29)
  » Low-level tragus stimulation (XML) | low-level transcutaneous electrical stimulation (XML) | low-level, transcutaneous stimulation of vagus nerve at the tragus (XML) | landfill leachate treatment station (XML) | lowest-lying triplet state (XML) ...
LLAEP  ( in XML )  (29)
  » long-latency auditory evoked potentials (XML) | long-latency acoustic evoked potentials (XML) | long-latency auditory event-related potential (XML) | long latency AEP components (XML) | long latency AEPs (XML) ...
L-Leu  ( in XML )  (28)
  » L-leucine (XML) | L-leucine polypeptides (XML) | L-Leu-Leu (XML)
LLU  ( in XML )  (28)
  » Loma Linda University (XML) | leukocyte ultrafiltrate (XML) | lower limb ulcers (XML) | long-lasting UC (XML) | laparoscopic ultrasonography (XML) ...
LLRT  ( in XML )  (28)
  » low-load resistance training (XML) | Linear linking for related traits (XML) | leg lateral reach test (XML) | log-likelihood ratio test (XML) | Limb Laterality Recognition Task (XML) ...
LLSCC  ( in XML )  (27)
  » lower lip squamous cell carcinoma (XML) | lower lip SCC (XML)
LLST  ( in XML )  (27)
  » limitation of life-sustaining treatment (XML) | limitation of life support treatment (XML) | low level stress test (XML) | legs lean soft tissue (XML) | lightweight, strong and tough cement-based material (XML) ...
LLPDD  ( in XML )  (25)
  » late luteal phase dysphoric disorder (XML)
LLMS  ( in XML )  (23)
  » lower-limb muscle strength (XML) | long lateral mass screw (XML) | Lower Limb Model for Safety (XML) | large language models (XML) | linear least mean square (XML) ...
LLSs  ( in XML )  (23)
  » long-lived states (XML) | long-lived spin states (XML) | liquid-like surfaces (XML) | leaflike structures (XML) | Lake Louise Scores (XML) ...
LLSS  ( in XML )  (23)
  » Lake Louise Scoring System (XML) | long-lived spin states (XML) | Lake Louise Symptom Score (XML) | laparoscopic liver skills scale (XML) | Later Life Status Score (XML) ...
LLLs  ( in XML )  (23)
  » lumenless leads (XML) | lumen-less pacing leads (XML) | low-level lasers (XML) | longitudinal length of the lesions (XML) | liquid-like layers (XML) ...
LLAC  ( in XML )  (22)
  » lower limb arterial calcification (XML) | lupus-like anticoagulant (XML) | liquid-liquid extraction followed by acidic hydrolysis (XML) | lingual augmented corticotomy (XML) | L-lactic acid concentration (XML)
LLPA  ( in XML )  (22)
  » low levels of physical activity (XML) | low light-intensity physical activity (XML) | left lateral para-aortic (XML) | late lactation protein A (XML) | Loveland Living Planet Aquarium (XML) ...
LLnL  ( in XML )  (22)
  » N-acetyl-L-leucyl-L-leucyl-L-norleucinal (XML) | N-acetyl-leu-leu-norleucinal (XML)
l-LA  ( in XML )  (22)
  » l-lactide (XML)
LLCI  ( in XML )  (21)
  » lower limb critical ischaemia (XML) | lower limit confidence interval (XML) | lower limb comfort index (XML) | lower limits of the CI (XML)
LLEs  ( in XML )  (21)
  » lower limb exoskeletons (XML) | largest Lyapunov exponents (XML) | lower limb events (XML) | LINE1-like elements (XML) | lupus-like events (XML) ...
LLDI  ( in XML )  (21)
  » Late Life Disability Instrument (XML) | Late Life Disability Index (XML) | Late Life Function and Disability Instrument (XML) | labiolingual dysfunction index (XML) | L-lysine diisocyanate (XML)
LLCA  ( in XML )  (21)
  » longitudinal latent class analysis (XML) | lower limit of cerebral autoregulation (XML) | Loneliness Scale for Children and Adolescents (XML) | lip line cant angle (XML) | large lumen catheter aspiration (XML) ...
LLTI  ( in XML )  (21)
  » limiting long-term illness (XML) | l-lysine triisocyanate (XML) | long-standing illness (XML)
LLFI  ( in XML )  (20)
  » Lower Limb Functional Index (XML) | low LFI (XML) | Late Life Function Instrument (XML) | LFI score: low (XML)
LL-37  ( in XML )  (20)
  » leucine-leucine-37 (XML) | [LL-37, 37 aa] (XML) | leucin-leucin-37 (XML) | LL-37 peptide (XML)
LLOV  ( in XML )  (19)
  » Lloviu virus (XML) | Lloviu cuevavirus (XML)
LLLME  ( in XML )  (19)
  » liquid-liquid-liquid microextraction (XML)
LLCS  ( in XML )  (18)
  » lower limb compartment syndrome (XML) | Lower Limb Core Scale (XML) | lyotropic liquid crystalline systems (XML) | locality-aware and long-range dependency concatenation strategy (XML) | long-lasting clinical symptoms (XML) ...
LLITNs  ( in XML )  (18)
  » long-lasting insecticide-treated nets (XML) | long-lasting-insecticide-treated bed nets (XML)
LLMIC  ( in XML )  (18)
  » low and lower-middle income countries (XML) | lower middle income countries (XML) | low and lower middle income (XML)
LLAT  ( in XML )  (17)
  » left lateral (XML) | lateral from the left side to the right side (XML)
LLDP  ( in XML )  (17)
  » left lateral decubitus position (XML) | liquid-liquid displacement porosimetry (XML) | link layer discovery protocol (XML) | lateral laparoscopic distal pancreatectomy (XML) | Lateral lumbar disc prosthesis (XML)
LL-VNS  ( in XML )  (17)
  » low-level vagus nerve stimulation (XML) | low-level vagosympathetic nerve stimulation (XML) | low-level VNS (XML)
Ll  ( in XML )  (17)
  » longissimus lumborum (XML) | labeling index (XML) | Locator light retention (XML) | Loa loa (XML) | luteal index (XML) ...
LLIP  ( in XML )  (17)
  » liquid-liquid interfacial precipitation (XML) | Long Lead Initial pulse (XML)
ll  ( in XML )  (16)
  » littleleaf (XML) | l allele homozygotes (XML) | limbless (XML) | l l $(epsilon)_ (XML) | long links (XML) ...
LLSR  ( in XML )  (16)
  » long-latency stretch reflex (XML) | long latency stretch response (XML) | linear least squares regression (XML) | Lake Louise Self-report Score (XML) | lung-liver signal ratio (XML) ...
LLSAN  ( in XML )  (16)
  » levator labii superioris alaeque nasi (XML) | labii superioris alaeque nasi muscle (XML) | LLS alaeque nasi (XML)
LLAS  ( in XML )  (16)
  » Lower Limb Assessment Score (XML) | lower limb assessment scale (XML) | LENA Language Autism Screen (XML) | Leadership Learning Agility Scale (XML) | low LAS (XML) ...
LLTO  ( in XML )  (15)
  » lithium lanthanum titanium oxide (XML) | Li3xLa2/3-xTiO3 (XML) | lithium lanthanum titanate, La2/3-xLi3xTiO3 (XML) | lithium lanthanum titanate perovskite (XML) | lithium-doped lanthanum titanate (XML) ...
LLHR  ( in XML )  (15)
  » low-load-high-repetitions (XML) | linear-linear homologous recombination (XML) | linear homologous recombination-mediated recombineering (XML) | leg-length-to-height ratio (XML) | low-load, higher-repetition training (XML) ...
LLPM  ( in XML )  (15)
  » layered learning practice model (XML) | leadless pacemaker (XML) | linear length of a positive margin (XML)
LLDA  ( in XML )  (15)
  » Local Linear Discriminant Analysis (XML) | low level disease activity (XML) | long-lasting degeneration argyrophilia (XML) | local LDA (XML) | local linear discrimination analysis (XML) ...
l-Lys  ( in XML )  (15)
  » l-lysine (XML)
LLTP  ( in XML )  (15)
  » large lipid transfer protein (XML) | landfill leachate treatment plant (XML) | late-stage LTP (XML)
LLSI  ( in XML )  (15)
  » limiting long-standing illness (XML) | limiting long-standing illness or disability (XML) | low levels of SIVmne infection (XML) | Local Latent Semantic Indexing (XML) | Lyme-Like Syndromic Illness (XML) ...
LLIE  ( in XML )  (15)
  » low-light image enhancement (XML)
LLSVPs  ( in XML )  (15)
  » large low-shear-velocity provinces (XML)
LLSIR  ( in XML )  (14)
  » lung-to-liver signal intensity ratio (XML) | lung/liver SIR (XML)
LLMD  ( in XML )  (14)
  » late-life major depression (XML) | Lower Limb Motor Dysfunction Following Stroke (XML) | late-life mortality deceleration (XML) | late-life major depressive disorder (XML) | Lyme-literate medical doctor (XML)
LLRW  ( in XML )  (14)
  » low-level radioactive waste (XML) | low-level radioactive liquid waste (XML) | low-level radioactive laboratory waste (XML)
LLTM  ( in XML )  (14)
  » linear logistic test model (XML) | low lean tissue mass (XML) | Late Lutetian Thermal Maximum (XML) | Linear Logistic Test Model(s) (XML) | Logistic Latent Trait Model (XML) ...
LLDH  ( in XML )  (14)
  » lateral lumbar disc herniations (XML) | laparoscopic living donor hepatectomy (XML) | living liver donor hepatectomy (XML) | lateral living donor hepatectomy (XML)
LLE-LTP  ( in XML )  (14)
  » liquid-liquid extraction with low temperature purification (XML)
LLAEPs  ( in XML )  (13)
  » long latency auditory evoked potentials (XML)
LLIS  ( in XML )  (13)
  » Lymphedema Life Impact Scale (XML) | Long-lasting insecticidal net screens (XML)
LLCR  ( in XML )  (13)
  » lifetime lung cancer risk (XML) | liver metastases and colorectal cancer (XML) | liver-to-lesion contrast ratio (XML) | Lower lateral cartilage repositioning (XML) | laparoscopic left-sided colon resection (XML) ...
LLC-PK1  ( in XML )  (13)
  » Lilly Laboratories Culture-Porcine Kidney 1 (XML) | Lewis lung carcinoma-porcine kidney-1 (XML) | Laboratories cell-porcine kidney 1 epithelial cells (XML) | LLC-Pig Kidney 1 (XML)
LLCER  ( in XML )  (13)
  » lesion-to-liver contrast enhancement ratio (XML) | liver-to-lesion contrast enhancement ratio (XML)
LLk  ( in XML )  (12)
  » low likelihood (XML)
LL'CT  ( in XML )  (12)
  » ligand-to-ligand charge transfer (XML) | LPtL', reveal charge-separated dichalcogenolene diimine charge-transfer (XML)
LLJ  ( in XML )  (12)
  » low-level jet (XML) | leaves of L. japonica (XML) | latero-lateral joint (XML) | laterale-jeffersonianum (XML)
LLHT  ( in XML )  (12)
  » ligand-to-ligand hydrogen transfer (XML) | ligand-to-ligand H-transfer (XML)
LLIR  ( in XML )  (12)
  » Look-Locker inversion recovery (XML) | linearized local impulse response (XML) | laminin-like immunoreactivity (XML) | low levels of ionizing radiation (XML) | liquid/liquid interfacial route (XML) ...
LLITN  ( in XML )  (12)
  » Long-lasting insecticide-treated bed nets (XML) | long-lasting insecticide treated mosquito nets (XML) | long-lasting insecticidal net (XML)
LLUMC  ( in XML )  (12)
  » Loma Linda University Medical Center (XML)
LLAD  ( in XML )  (11)
  » lower limb arterial disease (XML) | lower limb atherosclerotic disease (XML) | late-life anxiety disorders (XML) | longitudinal left atrial (XML) | Luer-Lok Access Device (XML) ...
l-Leu  ( in XML )  (11)
  » l-leucine (XML)
LLTL  ( in XML )  (11)
  » live low-train low (XML) | living low-training low (XML) | level with regular training only (XML) | living in normoxia with no additional maximal-intensity exercise (XML)
LLCZ  ( in XML )  (11)
  » luliconazole (XML)
LLRA  ( in XML )  (11)
  » low lateral right atrium (XML) | low-luminance binocular reading acuity (XML) | low lateral RA (XML) | Logistic Model with Relaxed Assumptions (XML)
LLZO  ( in XML )  (10)
  » lithium lanthanum zirconium oxide (XML) | lithium lanthanum zirconate (XML) | Li7-xLa3-aZr2-bO12 (XML) | Li-La-zirconate (XML) | Li7 La3 Zr2 O12-d (XML)
L-LR  ( in XML )  (10)
  » L-isomer only (XML) | L-lactated Ringer's (XML) | L-isomer LR (XML) | L-isomer lactated Ringer's (XML) | L-isomer of lactate (XML) ...
LLRP  ( in XML )  (10)
  » lower limb rehabilitation protocol (XML) | lower leg radiating pain (XML) | lower lid retractor plication (XML) | lower Liaohe River Plain (XML) | long-lasting refractory period (XML)
LLRL  ( in XML )  (10)
  » low-level red light (XML) | low-level red laser (XML)
LLOA  ( in XML )  (10)
  » lower limb osteoarthritis (XML) | Laparoscopic lysis of adhesions (XML) | lower limit of agreement (XML) | lower lateral orbital angle (XML)
LLBs  ( in XML )  (9)
  » lysosomal lamellar bodies (XML) | linear light bullets (XML) | liquid lithium batteries (XML) | lidocaine-impregnated ligation bands (XML) | lidocaine-loaded castration bands (XML) ...
LLCNPs  ( in XML )  (9)
  » lipid liquid crystalline nanoparticles (XML)
LLMDA  ( in XML )  (9)
  » Lawrence Livermore Microbial Detection Array (XML)
LLCD  ( in XML )  (9)
  » large liver cell dysplasia (XML) | liquid low-calorie diet program (XML) | Leadership Learning and Career Development (XML) | Liver cell dysplasia of large (XML)
LLRS  ( in XML )  (9)
  » lumbar lateral recess stenosis (XML) | Limb Lengthening and Reconstruction Society (XML) | lunar laser ranging system (XML) | low-level radioactive samples (XML) | locally low-rank and sparsity (XML) ...
LLUH  ( in XML )  (9)
  » Loma Linda University Health (XML)
LL-TS  ( in XML )  (9)
  » low-level tragus stimulation (XML)
LLBA  ( in XML )  (9)
  » Linguistics and Language Behavioral Abstracts (XML) | load in bronchoalveolar lavage fluid (XML)
L-lep  ( in XML )  (9)
  » lepromatous leprosy (XML)
L-LCNEC  ( in XML )  (9)
  » Lung large cell neuroendocrine carcinoma (XML) | large-cell neuroendocrine carcinoma of the lung (XML)
LLaMA  ( in XML )  (9)
  » Large Language Model Meta AI (XML) | LLM-based approach (XML) | Language Learning and Meaning Acquisition (XML)
LLTPs  ( in XML )  (9)
  » large lipid transfer proteins (XML) | landfill leachate treatment plants (XML)
LLFC  ( in XML )  (9)
  » life-limiting fetal condition (XML) | low liver fat content (XML) | liver fat (LFC) after calving in low (XML)
LLSPR  ( in XML )  (9)
  » longitudinal localized surface plasmon resonance (XML)
L-LPS  ( in XML )  (8)
  » leptospiral lipopolysaccharide (XML) | low-dose LPS (XML) | Leishmania lipopolysaccharide (XML)
LLSF  ( in XML )  (8)
  » Linear Least Squares Fit (XML) | linear least squares fitting (XML) | large Laplacian spatial filter (XML) | linear least-squares fitting method (XML)
LLK  ( in XML )  (8)
  » log-likelihood (XML) | locally linear K Nearest Neighbor (XML) | likelihood of CAD (XML) | likelihood (XML) | lung/liver/kidney (XML) ...
LLBFR  ( in XML )  (8)
  » low-load blood flow restriction (XML) | low-load exercise with BFR (XML) | low-load resistance exercise with blood flow restriction (XML) | low load training with BFR (XML)
LLFR  ( in XML )  (8)
  » long latency flexor reflex (XML) | lunate-lunate facet ratio (XML) | low-level fosfomycin resistance (XML) | lower limb flexion reflex (XML) | long-lasting facilitation of these reflexes (XML) ...
LLES  ( in XML )  (8)
  » lower lumbar erector spinae (XML) | lower limb exoskeleton (XML) | lower limb explosive strength (XML) | low-lying excited states (XML) | low-lying metal-centered electronic states (XML) ...
LLBNs  ( in XML )  (8)
  » long-lead burst neurons (XML)
LLRE  ( in XML )  (8)
  » low-load resistance exercise (XML) | low-level radioactive effluents (XML) | liquid-liquid refining extraction (XML) | late light response element (XML)
LL-TK  ( in XML )  (8)
  » lumbar lordosis minus thoracic kyphosis (XML) | LL minus TK (XML)
LLRC  ( in XML )  (8)
  » Latino legal residents/citizens (XML) | limb-loss rehabilitation continuum (XML) | legal Latino residents/citizens (XML) | Locally Linear Representation-based Classification (XML) | locally recurrent rectal cancer (XML) ...
LLAM  ( in XML )  (8)
  » lipid-laden alveolar macrophages (XML) | lipid-laden macrophage (XML) | linear-linear animal (XML)
LLE-GC-MS  ( in XML )  (8)
  » liquid-liquid extraction-gas chromatography-mass spectrometry (XML)
LLINEUP  ( in XML )  (8)
  » LLIN Evaluation in Uganda Project (XML)
LLA-CL  ( in XML )  (8)
  » low-cost, electrospun, nanoscale P (XML) | loose and porous structure of the electrospun collagen/P (XML) | low absolute alkaline and enzymatic hydrolyzability of the P (XML) | long-term follow-ups, anterior pelvic reconstruction surgery with a P (XML) | Lichtenstein inguinal hernia repair using electrospun P (XML) ...
LLCH  ( in XML )  (8)
  » low level continuous heat (XML) | localized Langerhans cell histiocytosis (XML) | Landfill leachate (XML) | Langerhans cell histiocytosis (XML) | localised LCH (XML)
LLRR  ( in XML )  (8)
  » lower limb rehabilitation robot (XML) | Laplacian regularized Low-Rank Representation (XML) | lower limb robotic rehabilitation (XML) | left-left-right-right (XML) | latent low-rank representation referred (XML) ...
LL2  ( in XML )  (8)
  » lymphomas using the rapidly internalizing antibody, anti-CD22 (XML) | lower limb pattern 2 (XML) | LOTUS LEAF 2 (XML) | LICR-LON-HMy2 (XML) | large loop 2 (XML) ...
LLTC  ( in XML )  (7)
  » lower-level trauma centers (XML) | lateral line trunk canal (XML) | lower limb trauma coordinator (XML) | laparoscopic Ligamentum Teres Cardiopexy (XML) | line or a tissue culture-adapted cell line (XML)
LLSQ  ( in XML )  (7)
  » linear least-squares (XML) | Lake Louise Score Questionnaire (XML)
LLy  ( in XML )  (7)
  » lymphoblastic lymphoma (XML)
L-L SUV R  ( in XML )  (7)
  » lesion to liver SUVmax ratio (XML)
LLFs  ( in XML )  (7)
  » lower limb fractures (XML) | line-like features (XML) | lipofuscin-like fluorophores (XML) | lateral LFs (XML) | lower-leg fractures (XML) ...
lly  ( in XML )  (7)
  » legiolysin (XML) | legiolysin gene (XML) | laboratory, legiolysin (XML)
LLLA  ( in XML )  (7)
  » Low-level laser acupuncture (XML) | left lower lobe atelectasis (XML) | lower lumbar lordosis angle (XML) | lower limb loading ability (XML)
LLDC  ( in XML )  (7)
  » Langerhans-like dendritic cells (XML) | large, less-dense cells (XML) | lower limit of detectable concentration (XML) | large low-density cell (XML) | Langerhans-like DC (XML) ...
LLLD  ( in XML )  (7)
  » lower limb length discrepancy (XML) | lobar lung living-donors (XML) | laparoscopic lateral lymph node dissection (XML) | localized-liquid-liquid-diffusion (XML) | long-label long-delay (XML)
LLSA  ( in XML )  (7)
  » low-dose low-specific-gravity spinal anesthesia (XML) | low-lethality suicide attempts (XML) | lower lobe segmental artery (XML) | Lifelong Learning and Self-assessment (XML) | Low-level Feature Spatial Attention (XML) ...
LL3  ( in XML )  (7)
  » LITAF-like 3 (XML) | lung-stage L3 (XML) | late L3 (XML) | LUX-Lung 3 (XML) | lung L3 (XML) ...
LL-BFRT  ( in XML )  (7)
  » low-load blood flow restriction training (XML) | Low-load blood flow restriction strength training (XML)
LLC-PK  ( in XML )  (7)
  » LLC porcine kidney (XML) | Lily Laboratory Culture, Porcine Kidney (XML)
LLOM  ( in XML )  (7)
  » lower-limb osteomyelitis (XML) | lower lip oral mucosa (XML) | low-level LOM (XML) | Leu-Leu-O-methyl (XML)
LLPTs  ( in XML )  (7)
  » liquid-liquid phase transitions (XML)
LLKS  ( in XML )  (7)
  » Lymphangioma-like Kaposi's sarcoma (XML) | lymphangioma-like KS (XML)
LLVV  ( in XML )  (7)
  » lower limb varicose veins (XML)
LLAPs  ( in XML )  (6)
  » Legionella-like amoebal pathogens (XML)
lLNvs  ( in XML )  (6)
  » large LNvs (XML) | large lateral ventral neurons (XML) | Large lateral ventral arousal neurons (XML) | large ventral-lateral neurons (XML)
LLRM  ( in XML )  (6)
  » Laplacian-likelihood-ratio method (XML) | Lasso-Logistics prediction model (XML) | LASSO logistic regression model (XML) | lamina and ligament repair model (XML) | Low Level of Response Model (XML)
LL-CBS  ( in XML )  (6)
  » low-level carotid baroreceptor stimulation (XML) | low-level CBS (XML)
LLDDs  ( in XML )  (6)
  » lethal lung developmental disorders (XML)
LLCPs  ( in XML )  (6)
  » liquid-liquid critical points (XML) | long-lived climate pollutants (XML) | linear liquid crystal polymers (XML) | Luminescent liquid crystalline polymers (XML) | Lyotropic liquid crystalline phases (XML)
l-LNvs  ( in XML )  (6)
  » large ventrolateral neurons (XML) | large lateral-ventral neurons (XML)
LLCC  ( in XML )  (6)
  » Lewis lung carcinoma cells (XML) | Large liver cell change (XML) | life-long cardiac care (XML) | lifelong chronic conditions (XML)
LLNR  ( in XML )  (6)
  » lateral lymph node recurrence (XML) | lateral-compartment LNR (XML)
LLCPS  ( in XML )  (6)
  » liquid-liquid crystalline phase separation (XML)
LL-RE  ( in XML )  (6)
  » low-load resistance exercise (XML)
LLGR  ( in XML )  (6)
  » lower leg growth rate (XML)
LLHA  ( in XML )  (6)
  » lower lingual holding arch (XML)
ll-DAP  ( in XML )  (6)
  » ll-diaminopimelic acid (XML) | l-lysine diaminopimelic acid (XML)
L-LMC  ( in XML )  (6)
  » lumbar lateral motor column (XML)
LLPP  ( in XML )  (6)
  » left lateroportal process (XML) | lymph lipid precursor pool (XML) | LPP in a linear distribution (XML)
LLG1  ( in XML )  (6)
  » LORELEI-LIKE GPI-ANCHORED PROTEIN1 (XML) | (LRE)-LIKE GLYCOSYLPHOSPHATIDYLINOSITOL (GPI)-ANCHORED PROTEIN 1 (XML) | LRE-like GPI-AP1 (XML) | Lorelei-Like Glycoprotein 1 (XML)
LLMC  ( in XML )  (6)
  » landfill leachate membrane concentrate (XML) | liquid-liquid membrane contactor (XML) | lipid-laden multilocular cells (XML)
LLER  ( in XML )  (6)
  » position--lower leg external rotation (XML) | low level electromagnetic radiation (XML) | lowlevel of experience region (XML) | Lost Life Expectancy Rate (XML) | least evolutionary resistance (XML)
LLGP  ( in XML )  (6)
  » lentil lectin purified glycoprotein (XML) | lentil-lectin-purified glycoproteins from T. solium Ag (XML) | lentil lectin-bound glycoproteins (XML)
l-LDH  ( in XML )  (6)
  » l-lactate dehydrogenase (XML)
LLEC  ( in XML )  (6)
  » L,L, ethylenedicysteine (XML) | long-lived effector cells (XML) | lower lip epidermoid carcinoma (XML) | Leptomeningeal Lymphatic Endothelial Cells (XML) | label-less learning for emotion cognition (XML) ...
LLCa  ( in XML )  (6)
  » Lewis lung carcinoma (XML) | Lewis Lung carcinoma cells (XML)
LLOS  ( in XML )  (6)
  » long length of stay (XML) | Lower Leg Outcome Survey (XML) | liver transplantation (XML) | lower-limb orthopedic surgery (XML)
LLPMs  ( in XML )  (6)
  » leadless pacemakers (XML) | leadless cardiac pacemakers (XML)
LLNAs  ( in XML )  (6)
  » local lymph node assays (XML)
LLODs  ( in XML )  (6)
  » lower limits of detection (XML)
LLLR  ( in XML )  (6)
  » low-level laser radiation (XML) | lateral segment liver resection (XML) | laparoscopic limited liver resections (XML)
LLX  ( in XML )  (6)
  » liquid-liquid extraction (XML) | leader-leader exchange (XML)
LLTT  ( in XML )  (5)
  » low level technology tool (XML) | Longiflorum x Trumpet hybrid (XML) | low-level laser treatment (XML) | low-level treadmill tests (XML)
LLPL  ( in XML )  (5)
  » LCAT-like lysophospholipase (XML) | lower-leg proprioceptive loss (XML) | limited laparoscopic pelvic lymphadenectomy (XML) | acyltransferase-like lysophospholipase (XML)
LLP-1  ( in XML )  (5)
  » lentivirus lytic peptide 1 (XML) | lentivirus lytic peptides segment 1 (XML) | lentiviral lytic peptide type 1 (XML)
LLHD  ( in XML )  (5)
  » low latency and high data rate (XML) | lean-led hospital design (XML) | left lateral hepatic duct (XML)
LLVD  ( in XML )  (5)
  » lower-limb varicose disease (XML) | locoregional lung ventilation distribution (XML) | lower limb vascular disease (XML) | lower limb venous Duplex (XML)
LLMB  ( in XML )  (5)
  » lower limb motor blocks (XML) | low-lying muscle belly (XML) | lean lithium metal battery (XML) | Low-lying peroneus brevis muscle belly (XML)
LLQR  ( in XML )  (5)
  » low-level quinolone resistance (XML)
LLLH  ( in XML )  (5)
  » laparoscopic left lateral hepatectomy (XML) | Longitudinal Late-Life Health study (XML)
LLY  ( in XML )  (5)
  » lectinolysin (XML) | LandraceLandraceYorkshire (XML) | Leu-Leu-Tyr (XML) | lost life-years (XML)
LLP2  ( in XML )  (5)
  » lentiviral lytic peptide 2 (XML)
lle  ( in XML )  (5)
  » long, located between rrnS and tRNA (XML) | lower lens-eye (XML) | L. striatellus was found between srRNA and tRNA (XML) | low levels of estrogen (XML)
LLVR  ( in XML )  (5)
  » Laparoscopic low ventral rectocolpopexy (XML) | Late LVR (XML) | left renal vein (XML) | lens thickness, real vitreous chamber depth and retinal thickness (XML) | low-level viral rebound (XML)
LLLV  ( in XML )  (5)
  » lower leg length velocity (XML) | LLL velocity (XML)
lll  ( in XML )  (5)
  » little with extractant, which implies that most of the Fe (XML) | largely determined by the filterability of Cr (XML) | ligands are able to selectively extract Am (XML) | ligands with variable conditional stability constants for Fe (XML) | likely to play a major role in Fe (XML)
LL1  ( in XML )  (5)
  » lower limb pattern 1 (XML) | large loop 1 (XML) | L1210 murine leukemia cells (XML) | Longlin 1 (XML) | LOTUS LEAF 1 (XML)
LLCPA  ( in XML )  (5)
  » lateral lamella-cribriform plate angle (XML) | lateral lamella and cribriform plate (XML) | lamella and the cribriform plate (XML) | lateral lamella CP angle (XML)
LLAF  ( in XML )  (5)
  » lipofuscin-like autofluorescence (XML) | long leg alignment films (XML)
LLDF  ( in XML )  (5)
  » low-level data fusion (XML) | Longitudinal Log-Demons Framework (XML)
LL-DAP-AT  ( in XML )  (5)
  » LL-diaminopimelate aminotransferase (XML)
LLPI  ( in XML )  (5)
  » long-lasting permethrin impregnated (XML) | long-lasting protection inducer (XML)
L-LPM  ( in XML )  (5)
  » left-lateral plate mesoderm (XML) | lateral premotor cortex (XML)
LLE-SPE  ( in XML )  (5)
  » liquid-liquid extraction followed by solid-phase extraction (XML)
LLC1  ( in XML )  (5)
  » Lewis lung carcinoma 1 (XML) | Lewis lung cancer 1 (XML)
LLPR  ( in XML )  (5)
  » Limb Loss and Preservation Registry (XML) | linearized local perturbation response (XML) | large-lesion-poor-recovery (XML) | Lower limb power rehabilitation (XML)
LLDRH  ( in XML )  (5)
  » laparoscopic living donor right hemihepatectomy (XML)
LLZTO  ( in XML )  (5)
  » lithium lanthanum zirconate (XML) | lithium lanthanum zirconium oxide (XML) | Li2CO3-free Li6.4La3Zr1.4Ta0.6O12 (XML) | LiLaZrTaO (XML) | PVDF-HFP-LiClO4-Li6.4La3Zr1.4Ta0.6O12 (XML)
LLTE  ( in XML )  (5)
  » lower leg trajectory error (XML) | listening and treatment explanations (XML)
lldD  ( in XML )  (5)
  » L-lactate dehydrogenase (XML) | L-lactate dehydrogenase gene from Escherichia coli (XML)
LLCM  ( in XML )  (5)
  » lyotropic liquid crystalline mesophases (XML) | Low-Latency, Continuous-Motion (XML) | light-chain myeloma (XML) | Lewis Lung Carcinoma conditioned media (XML)
LLZ  ( in XML )  (5)
  » LL-Z1640-2 (XML) | Lilizhi (XML) | Lower-Longevity Zone (XML) | low-lying mountain zone (XML) | low-lying zone (XML)
L-L IBR  ( in XML )  (5)
  » liquid-liquid interface bioreactor (XML)
LLTA  ( in XML )  (5)
  » laparoscopic-assisted left thoracoabdominal esophagectomy (XML) | long-lasting tonic activation (XML) | laparoscopic liver tumor ablation (XML)
LLNP  ( in XML )  (5)
  » local lymph node proliferation assay (XML) | lower leg negative pressure (XML) | LiLa(1-x)Nd(x)(PO(3))(4) (XML) | Lachua National Park (XML)
LLFE  ( in XML )  (4)
  » Leucas lavandulaefolia (XML) | Ligustrumlucidum fruit extract (XML) | lotus leaf flavonoid extract (XML)
LLT-ESP  ( in XML )  (4)
  » low-low temperature electrostatic precipitator (XML)
LLOMe  ( in XML )  (4)
  » Leu-Leu-OMe (XML) | l-leucyl-l-leucine O-methyl ester (XML)
LLPUs  ( in XML )  (4)
  » lower limb prosthesis users (XML)
LLMPP  ( in XML )  (4)
  » Leukemia/Lymphoma Molecular Profiling Project (XML) | Lymphoma/Leukemia Molecular Profiling Project (XML)
LLPO  ( in XML )  (4)
  » long-lived photooxidants (XML)
LLS1  ( in XML )  (4)
  » LATERAL LEAFLET SUPPRESSION1 (XML) | LETHAL LEAF SPOT1 (XML) | Lateral Leaflet Suppression 1 (XML) | lethal leaf spot 1 (XML)
L-LMICs  ( in XML )  (4)
  » low- and lower-middle-income countries (XML) | low-income or lower-middle-income countries (XML)
LL-TRD  ( in XML )  (4)
  » late-life treatment-resistant depression (XML) | late-life TRD (XML)
LLC-SD  ( in XML )  (4)
  » LLC-Symmetric Division (XML) | Lewis lung adenocarcinoma SD (XML) | largely symmetric division for self-renewal (XML)
LLFDI-CAT  ( in XML )  (4)
  » Late-Life Function and Disability Instrument Computer Adaptive Test (XML)
LLCE  ( in XML )  (4)
  » liquid-liquid cartridge extraction (XML) | liquid-liquid continuous extraction (XML) | lower limbs cycle ergometer (XML)
LLIFs  ( in XML )  (4)
  » lateral lumbar interbody fusions (XML) | lateral lumbar intervertebral fusions (XML)
LLCNs  ( in XML )  (4)
  » lipid liquid crystalline nanoparticles (XML)
LLHs  ( in XML )  (4)
  » low-level heuristics (XML) | layered lanthanide hydroxides (XML)
LLBO  ( in XML )  (4)
  » Laser Light-Based Opacitometer (XML)
LLMR  ( in XML )  (4)
  » low-level mupirocin resistance (XML) | lower limb muscle ratio (XML)
LLSC  ( in XML )  (4)
  » lateral lumbar spinal canal (XML) | long-lasting Silastic catheter (XML) | lumbar spinal canal (XML) | Living Lab on Sharing and Circular Economy (XML)
LLSE  ( in XML )  (4)
  » language learning self-efficacy (XML) | left side-lying sling exercise (XML) | linear least square error (XML) | liquid-liquid solvent extraction (XML)
LLSV  ( in XML )  (4)
  » low ligation of spermatic vessels (XML) | left lateral segment volume (XML) | leg large subcutaneous vein (XML)
LLDT  ( in XML )  (4)
  » lipid-lowering drug treatment (XML) | lateralized lexical decision task (XML) | lower lid distraction test (XML)
L. Lactis  ( in XML )  (4)
  » lactococcus lactis (XML) | Leuconostoc lactis (XML)
LLWR  ( in XML )  (4)
  » least limiting water range (XML)
LLBD  ( in XML )  (4)
  » late-life bipolar disorder (XML) | light and laser-based devices (XML) | Live Life Better Derbyshire (XML)
LLSG  ( in XML )  (4)
  » left lateral segment graft (XML) | lower lumbar stability group (XML) | large litter size group (XML) | laser light-scattering granulometer (XML)
LLMT  ( in XML )  (4)
  » lower lid margin thickness (XML)
LLAMA  ( in XML )  (4)
  » Lyman-Alpha Measurement Apparatus (XML) | Lead-Likeness and Molecular Analysis (XML)
LLGs  ( in XML )  (4)
  » legume lost genes (XML) | local liver grafts (XML) | larger litter size groups (XML) | left lobe grafts (XML)
LLABCs  ( in XML )  (4)
  » locally advanced breast cancers (XML)
LLBW  ( in XML )  (4)
  » lighter low birth weight (XML) | lung, liver, and body weights (XML) | Lingual, labial and buccal weakness (XML)
LL/BL  ( in XML )  (4)
  » lepromatous/borderline lepromatous (XML) | leprosy/borderline leprosy (XML)
LLm  ( in XML )  (4)
  » lumbar lordosis (XML) | lumbar lordosis measured (XML)
LLTH  ( in XML )  (4)
  » live-low train-high (XML) | living low-training high (XML) | living-low and training-high (XML)
LLP3  ( in XML )  (4)
  » lentiviral lytic peptide 3 (XML) | lentiviral lytic peptide-3 motif (XML)
LLRD  ( in XML )  (4)
  » long-lived radioactive dust (XML) | long-latency respiratory disease (XML) | life-limiting rare diseases (XML)
LLSCCs  ( in XML )  (4)
  » lower lip squamous cell carcinomas (XML)
L. luteola  ( in XML )  (4)
  » Lymnaea luteola (XML)
LLRF  ( in XML )  (4)
  » Low-level rf (XML) | low-level radio frequency (XML)
LLFP  ( in XML )  (4)
  » ligamentum flavum process (XML) | long-lived fission products (XML) | LLF pneumonia (XML) | Label Fuzzy Proportions (XML)
LL-EPI  ( in XML )  (4)
  » Look-Locker echo-planar imaging (XML) | Look-Locker EPI (XML)
LLSimpute  ( in XML )  (4)
  » local least squares imputation (XML)
lld  ( in XML )  (4)
  » leaflet development (XML) | lower level discriminators (XML)
LLFTB  ( in XML )  (4)
  » lower-lung-field TB (XML) | lower lung field tuberculosis (XML)
LLMCs  ( in XML )  (4)
  » landfill leachate membrane concentrates (XML) | Liquid-liquid membrane contactors (XML)
LLIH  ( in XML )  (4)
  » long-lasting insecticidal hammocks (XML) | long-lasting insecticide-treated hammock (XML)
LLGL2  ( in XML )  (4)
  » lethal giant larvae 2 (XML) | Lethal giant larvae homolog 2 (XML) | larvae homolog 2 (Drosophila) (XML)
LLMP  ( in XML )  (4)
  » lower limb movement patterns (XML) | log-linear model with Poisson distribution (XML) | lower limit of melodic pitch (XML) | lower limb muscle power (XML)
LLMM  ( in XML )  (4)
  » lower limb muscle mass (XML) | lower-leg muscle mass (XML) | longitudinal linear mixed model (XML)
LLNC  ( in XML )  (4)
  » landfill leachate nanofiltration concentrate (XML)
LLOAD  ( in XML )  (3)
  » lower-limb occlusive arterial disease (XML)
LLFPs  ( in XML )  (3)
  » long-lived fission products (XML)
LLCCs  ( in XML )  (3)
  » Long linear carbon chains (XML) | long LCCs (XML) | Lewis lung carcinoma cells (XML)
LLf  ( in XML )  (3)
  » low-dose Lf (XML) | low-dose Lf treatment group (XML)
LL7  ( in XML )  (3)
  » LUX-Lung 7 (XML) | Lactococcus lactis at 107 CFU/g (XML)
LLTTF  ( in XML )  (3)
  » Living Life to the Full (XML) | Life to the Full (XML)
LLACs  ( in XML )  (3)
  » lupus-like anticoagulants (XML) | lower leg arterial calcifications (XML)
LLAPTR  ( in XML )  (3)
  » Long-lasting allergic patch test reactions (XML)
LLGPs  ( in XML )  (3)
  » lentil lectin-purified glycoproteins (XML)
LLTO/C  ( in XML )  (3)
  » lithium lanthanum titanate/carbon (XML) | lithium lanthanum titanium oxide/carbon (XML)
LLSL  ( in XML )  (3)
  » low-level sick leave (XML) | long-lived small lymphocytes (XML)
L-LV  ( in XML )  (3)
  » lateral left ventricle (XML) | L-leucovorin (XML)
LLLM  ( in XML )  (3)
  » lower limb lean-mass (XML)
LLPSs  ( in XML )  (3)
  » liquid-liquid phase separations (XML)
LLUS  ( in XML )  (3)
  » late leakage of undetermined source (XML)
L-LLS  ( in XML )  (3)
  » laparoscopic LLS (XML) | left lateral sectionectomy (XML)
LLPV  ( in XML )  (3)
  » left lower pulmonary vein (XML)
L-LAC  ( in XML )  (3)
  » l-lactate concentrations (XML) | l-lactate (XML)
LLC's  ( in XML )  (3)
  » long-lived coherences (XML)
LL-III  ( in XML )  (3)
  » lasioglossin-III (XML)
LLNL's  ( in XML )  (3)
  » Lawrence Livermore National Laboratory's (XML)
LL-PI  ( in XML )  (3)
  » lumbar lordosis-pelvic incidence (XML) | LL-pelvic incidence (XML)
LLOI  ( in XML )  (3)
  » lower leg overuse injury (XML) | Lower limit of identification (XML)
LLUs  ( in XML )  (3)
  » lower-limb ulcers (XML)
LLBT  ( in XML )  (3)
  » lasers and light-based therapies (XML) | log-linear Bradley-Terry (XML)
LLVL  ( in XML )  (3)
  » low-level viral load (XML) | Low-level visible light (XML)
LLAMS  ( in XML )  (3)
  » Lower Limb Amputee Measurement Scale (XML) | Lower Limb Extremity Amputee Measurement Scale (XML) | lumen apposing metal stent (XML)
LLPv2  ( in XML )  (3)
  » Liverpool Lung Project V.2 (XML) | Liverpool Lung Project version 2 (XML)
LLIL  ( in XML )  (3)
  » low-level infrared laser (XML) | lateral incisor length (XML)
LLDB  ( in XML )  (3)
  » Large linked databases (XML) | Learning-based Local Difference Binary (XML)
LLPi  ( in XML )  (3)
  » Liverpool lung project incidence risk model (XML) | Liverpool Lung Project Risk Prediction Model for Lung Cancer Incidence (XML) | LLP Incidence Risk Model (XML)
LL-CL  ( in XML )  (3)
  » low-level chemiluminescence (XML)
LLIVCT  ( in XML )  (3)
  » ligand-to-ligand intervalence charge transfer (XML)
LLHM  ( in XML )  (3)
  » Local Linear Histogram Matching (XML) | Lewis lung high metastatic (XML) | Laparoscopic limited Heller myotomy (XML)
LLE/AD  ( in XML )  (3)
  » limited life expectancy and/or advanced dementia (XML) | LLE and/or advanced dementia (XML)
LLVS  ( in XML )  (3)
  » low-level vagosympathetic trunk stimulation (XML) | low-level vagus nerve stimulation (XML) | low-luminance visual stimulation (XML)
LLNWP  ( in XML )  (3)
  » Lotus Lake National Wetland Park (XML) | low-latitude northwestern Pacific (XML)
LLPv3  ( in XML )  (3)
  » Liverpool Lung Project version 3 (XML) | Liverpool Lung cancer Project risk model version 3 (XML)
LLHS  ( in XML )  (3)
  » leaf litter-derived humic substance (XML) | low light-human segmentation (XML)
LLC cells  ( in XML )  (3)
  » Lewis lung cancer cells (XML) | Lewis lung carcinoma cells (XML)
LLBP  ( in XML )  (3)
  » local line binary pattern (XML) | LBP divided into groups reporting low (XML)
L-LME  ( in XML )  (3)
  » L-leucine methyl ester (XML)
LLMO  ( in XML )  (3)
  » lithium-rich manganese-based cathode materials (XML) | layered lithium-rich manganese oxide-based (XML) | I-Low lean mass and Osteoporosis (XML)
L-line  ( in XML )  (3)
  » lethal-line (XML) | low female reproductive investment (XML) | line selected against backfat thickness (XML)
L-LEP  ( in XML )  (3)
  » Lepromatous leprosy (XML) | limited English proficiency (XML)
LLLE  ( in XML )  (3)
  » lower-limb lymphatic edema (XML) | lower limb lymphedema (XML) | Liquid-liquid-liquid equilibria (XML)
L-LTD  ( in XML )  (3)
  » late-phase long-term synaptic depression (XML) | late-LTD (XML) | Late-phase long-term depression (XML)
LLNS  ( in XML )  (3)
  » Landau-Lifshitz-Navier-Stokes (XML) | low-level neurological state (XML)
l-LTP  ( in XML )  (3)
  » Late long-term potentiation (XML) | late-LTP (XML)
LLABC  ( in XML )  (3)
  » locally advanced breast cancer (XML) | LL resin was additionally tested with an air-barrier coating (XML)
LL-KF140  ( in XML )  (3)
  » Lactococcus lactis KF140 (XML)
LL-VMB  ( in XML )  (3)
  » low-Lactobacillus vaginal microbiota (XML)
LLGL  ( in XML )  (3)
  » liquid light-guide lens (XML) | Llglh gene (XML)
LLDR  ( in XML )  (3)
  » leg-length discrepancy ratio (XML) | long-lasting depression of reflexes (XML)
LLAP  ( in XML )  (3)
  » Legionella-like amoebal pathogen (XML) | lower limb adjusted perimeter (XML)
LLFDI-FC  ( in XML )  (3)
  » Late-Life Function and Disability Instrument Function Component (XML) | LLFDI-Function Component (XML)
LLE ratio  ( in XML )  (3)
  » lung-to-liver elastography ratio (XML)
LLIM  ( in XML )  (3)
  » liquid/liquid interface microsensor (XML) | Luminescence lifetime imaging (XML) | Limited Literacy Impact Measure (XML)
LLSelf  ( in XML )  (3)
  » Lake Louise AMS Self-report Score (XML)
LLSVP  ( in XML )  (3)
  » large low-shear-velocity province (XML)
LLFT  ( in XML )  (3)
  » lateral ligament flavum thickness (XML) | locally leptokurtic and fat-tailed (XML) | lower-limb fatigue (XML)
LLaMA2  ( in XML )  (3)
  » LLM Meta AI 2 (XML) | Language Models by Meta AI 2 (XML) | Large Language Model Meta AI-2 (XML)
LLECs  ( in XML )  (3)
  » leptomeningeal lymphatic endothelial cells (XML) | long-lived effector cells (XML)
LLDME  ( in XML )  (3)
  » Locally Linear Diffeomorphic Metric Embedding (XML)
LL-GBP  ( in XML )  (3)
  » long-limb bypass (XML) | long-limb GBP (XML) | long-limb gastric bypass (XML)
LLPN  ( in XML )  (3)
  » laser-assisted LPN (XML) | laser-assisted laparoscopic partial nephrectomy technique (XML)
LLPU  ( in XML )  (3)
  » lower limb prosthetic users (XML) | liquefied lignin-based polyurethane (XML)
LLSME  ( in XML )  (3)
  » liquid-liquid-solid microextraction (XML)
L-loop  ( in XML )  (3)
  » luminal loop (XML) | left-sided morphological right ventricle and right-sided morphological left ventricle (XML) | larger loop (XML)
LLCB  ( in XML )  (3)
  » linear latent causal Bayes (XML) | longest side-length of a circumscribed box (XML)
LLGP-EITB  ( in XML )  (3)
  » lentil lectin-bound glycoproteins/enzyme-linked immunoelectrotransfer blot (XML)
LLDVT  ( in XML )  (3)
  » lower limb deep vein thrombosis (XML)
LLMZ  ( in XML )  (3)
  » leg lean mass z-score (XML)
LLIEP  ( in XML )  (3)
  » low-lying-implantation ectopic pregnancy (XML)
LLRT-BFR  ( in XML )  (3)
  » low-load resistance training with blood flow restriction (XML)
LLGC  ( in XML )  (3)
  » local and global consistency method (XML) | Longitudinal latent growth curve (XML) | Lymphoepithelioma-like gastric carcinoma (XML)
LLTQ  ( in XML )  (3)
  » Lower Limb Tasks Questionnaire (XML)
LLv  ( in XML )  (3)
  » lemnisci lateralis, pars ventralis (XML) | lateral lemniscus, pars ventralis (XML)
LLLL  ( in XML )  (3)
  » lateral liver lobectomy (XML) | late-life language learning (XML) | Low-level laser-assisted liposuction (XML)
LLPD  ( in XML )  (3)
  » late luteal phase dysphoric disorder (XML) | late-life psychotic depression (XML)
LLM's  ( in XML )  (2)
  » local linear maps (XML) | large language models (XML)
L-LS  ( in XML )  (2)
  » LyP-1-conjugated liposomes (XML) | low-dose laser treatment group (XML)
Llgl2  ( in XML )  (2)
  » LLGL Scribble cell polarity complex component 2 (XML) | lethal giant larvae 2 (XML)
LLD-KQ  ( in XML )  (2)
  » Later Life Depression Knowledge Questionnaire (XML)
L. litseifolius  ( in XML )  (2)
  » Lithocarpus litseifolius (XML) | Lithocarpus litseifolius (Hance) Chun (XML)
LLYHZ  ( in XML )  (2)
  » Long-Liang-You-Hua-Zhan (XML) | Longliangyou Huazhan (XML)
LLMG  ( in XML )  (2)
  » lower-lip mucosal graft (XML) | Lieb-Liniger-McGuire (XML)
LLETZ-cone  ( in XML )  (2)
  » large loop excision of transformation zone, as a cone procedure (XML) | Large Loop Excision of the Transformation Zone (XML)
LLVC  ( in XML )  (2)
  » lateral lingual vascular canal (XML) | lymphatic limbal vascular complex (XML)
LLLND  ( in XML )  (2)
  » lateral lymph node dissection for rectal cancer group (XML) | laparoscopic lateral lymph node dissection (XML)
LLSW  ( in XML )  (2)
  » longitudinal leaky surface waves (XML)
LLCBF  ( in XML )  (2)
  » lower limit of cerebral blood flow autoregulation (XML) | lower limit of CBF autoregulation (XML)
LLFV  ( in XML )  (2)
  » lunate-lunate facet variance (XML) | Local low-frequency vibration (XML)
L-Leu-L-Pro  ( in XML )  (2)
  » levels found in dough prior to baking. cis-Cyclo (XML) | liquid chromatography (HPLC) was performed to explore cyclo (XML)
LLR-Ro  ( in XML )  (2)
  » lower limb rehabilitation robot (XML)
LLLT.G  ( in XML )  (2)
  » LLLT group (XML)
LLSD  ( in XML )  (2)
  » lower limb sensory deficits (XML) | lymphadenoma lacking sebaceous differentiation (XML)
LLSTs  ( in XML )  (2)
  » large lateral spreading tumors (XML) | limitations on life support techniques (XML)
l,l-DAP  ( in XML )  (2)
  » l,l-diaminopimelate (XML) | l,l-diaminopimelic acid (XML)
Lla-Met  ( in XML )  (2)
  » compound-linolenic acid-metronidazole (XML) | linolenic acid-metronidazole (XML)
LLPHF  ( in XML )  (2)
  » low-level private health facilities (XML)
LLVY  ( in XML )  (2)
  » N-succinyl-Leu-Leu-Val-Tyr 7-amino-4-methylcoumarin (XML) | Suc-Leu-Leu-Val-Tyr-AMC (XML)
lls  ( in XML )  (2)
  » listeriolysin S (XML)
LLDKT  ( in XML )  (2)
  » living donor kidney transplantation (XML)
Llo PRP  ( in XML )  (2)
  » leukocyte-low platelet rich plasma (XML) | low-leukocyte PRP (XML)
LLL Biostimulation  ( in XML )  (2)
  » low level laser therapy biostimulation (XML)
LLCV  ( in XML )  (2)
  » lilac leaf chlorosis virus (XML)
LLFQ  ( in XML )  (2)
  » Lower Limb Function Questionnaire (XML)
LL-OEW  ( in XML )  (2)
  » Light Line Optoelectrowetting (XML) | light line OEW (XML)
LLDNs  ( in XML )  (2)
  » lower-limb drainage nodes (XML) | laparoscopic living-donor nephrectomies (XML)
LLBS  ( in XML )  (2)
  » LLBS shoes than in the HLBS shoes (XML) | lower limb bypass surgery (XML)
LLD3  ( in XML )  (2)
  » low ligation of the IMA with D3 dissection (XML) | ligation D3 lymph node dissection (XML)
LLT-ESPs  ( in XML )  (2)
  » low-low temperature electrostatic precipitators (XML) | low-low-temperature ESPs (XML)
l,l-SDAP  ( in XML )  (2)
  » N-succinyl-l,l-diaminopimelic acid (XML)
LLac  ( in XML )  (2)
  » Leuconostoc lactis (XML) | low light-acclimated (XML)
LLP1  ( in XML )  (2)
  » LECTIN-LIKE PROTEIN1 (XML)
L,L-DAP  ( in XML )  (2)
  » L,L-diaminopimelate (XML) | L,L-diaminopimelic acid (XML)
LLPHFs  ( in XML )  (2)
  » low-level private health facilities (XML)
LLTIs  ( in XML )  (2)
  » life- and limb-threatening injuries (XML)
LLOC  ( in XML )  (2)
  » lowest level of consciousness (XML) | left occipital condyle (XML)
LLDL  ( in XML )  (2)
  » low-level diode laser (XML)
LLD-S  ( in XML )  (2)
  » LLD patients with suicidal ideation (XML)
L-LBM  ( in XML )  (2)
  » limb lean body mass (XML)
LLMPs  ( in XML )  (2)
  » local labour market programmes (XML) | late-life mortality plateaus (XML)
L-LMS  ( in XML )  (2)
  » lipoleiomyosarcomas (XML)
LLRRs  ( in XML )  (2)
  » long latency reflex responses (XML) | Lower limb rehabilitation robots (XML)
LLSAWs  ( in XML )  (2)
  » longitudinal leaky SAWs (XML)
LLD-NS  ( in XML )  (2)
  » LLD patients without suicidal ideation (XML)
LLAA  ( in XML )  (2)
  » Low-liquid aqueous ammonia (XML) | LAA ligation (XML)
L-LAMP  ( in XML )  (2)
  » Lyophilised Loop Mediated Isothermal Amplification (XML)
LLVPs  ( in XML )  (2)
  » large low-velocity provinces (XML)
LLGCV  ( in XML )  (2)
  » L-Val-L-Val-GCV (XML)
l-lat  ( in XML )  (2)
  » left-lateral position (XML)
LLCNR  ( in XML )  (2)
  » lesion-to-liver contrast-to-noise ratio (XML)
LLON  ( in XML )  (2)
  » Leprous late-onset neuropathy (XML)
LLDPEs  ( in XML )  (2)
  » linear low-density PEs (XML) | linear low-density polyethylenes (XML)
L-L-L  ( in XML )  (2)
  » low walkability/transit/recreation (XML)
LL-BFRE  ( in XML )  (2)
  » low-load blood flow restriction exercises (XML)
llf  ( in XML )  (2)
  » large leaf (XML) | lateral funiculi (XML)
LlPDS  ( in XML )  (2)
  » L. leichtlinii phytoene desaturase (XML)
LLDAV  ( in XML )  (2)
  » lamium leaf distortion-associated virus (XML)
LL-EP  ( in XML )  (2)
  » lower lip protrusion (XML) | lips relative to the esthetic plane (XML)
Lls1  ( in XML )  (2)
  » lethal leaf spot 1 (XML)
LLoC  ( in XML )  (2)
  » liver-lobule-chip (XML)
L-LDL  ( in XML )  (2)
  » large low-density lipoprotein (XML) | low LDL-C (XML)
lli  ( in XML )  (2)
  » leafless inflorescence (XML)
L-LNR  ( in XML )  (2)
  » low-LNR (XML)
LL2-Luc2  ( in XML )  (2)
  » Lung 2-luciferase 2 cells (XML)
LLSB  ( in XML )  (2)
  » locking-loop suture bridge (XML) | long-lasting slow bursting (XML)
LLK48  ( in XML )  (2)
  » Lactococcus lactis KUST48 (XML) | L. lactis KUST48 (XML)
LL-BCVA  ( in XML )  (2)
  » low-luminance BCVA (XML)
L-lysine-HCl  ( in XML )  (2)
  » L-lysine hydrochloride (XML) | levels mentioned could be achieved by lysine supplements (XML)
LL-HL  ( in XML )  (2)
  » low-light-to-high-light (XML) | LL plants were transferred to a high-sunlight environment (XML)
L. lactis NZ9000  ( in XML )  (2)
  » Lactococcus lactis NZ9000 (XML)
LLSSE  ( in XML )  (2)
  » Life Study of Social Exchanges (XML)
LLRY  ( in XML )  (2)
  » long loop Roux-en-Y gastrojejunostomy (XML) | long-limb Roux-en-Y (XML)
LL-TFE  ( in XML )  (2)
  » Look-Locker turbo-field-echo (XML)
L-LDHs  ( in XML )  (2)
  » l-lactate dehydrogenases (XML)
LLMDs  ( in XML )  (2)
  » Late-life mood disorders (XML)
LLTRD  ( in XML )  (2)
  » late-life treatmentresistant depression (XML)
LLPE  ( in XML )  (2)
  » lifelong PE (XML) | left-sided LPE (XML)
lls1  ( in XML )  (2)
  » lethal leaf spot1 (XML) | long life span 1 (XML)
lLOC  ( in XML )  (2)
  » left lateral occipital cortex (XML)
llb  ( in XML )  (2)
  » lethal left of bithorax gene (XML) | lullaby (XML)
LLys  ( in XML )  (2)
  » lipoyllysine (XML)
LLTV  ( in XML )  (2)
  » Lipoblastoma-like tumor of the vulva (XML) | loose-leaf tobacco vaporizer (XML)
LLOQ QC  ( in XML )  (2)
  » limit of quantification of quality control (XML)
LLRNN  ( in XML )  (2)
  » low-delay lightweight recurrent neural network (XML)
LLCMs  ( in XML )  (2)
  » lyotropic liquid crystalline mesophases (XML) | Luminescent liquid crystal materials (XML)
LLMIs  ( in XML )  (2)
  » lower limit of measuring intervals (XML) | lower limb muscle injuries (XML)
L-LUS  ( in XML )  (2)
  » Laparoscopy with laparoscopic ultrasonography (XML)
LLFFM  ( in XML )  (2)
  » lower-limb FFM (XML) | lower limb fat-free (XML)
LLLvel  ( in XML )  (2)
  » lower leg length velocity (XML) | LLL velocity (XML)
LLGHGs  ( in XML )  (2)
  » long-lived greenhouse gases (XML)
LLTG  ( in XML )  (2)
  » Lipid-lowering therapy Group (XML) | low load training group (XML)
LLC-GEN  ( in XML )  (2)
  » lyotropic liquid crystal genistein-based formulation (XML)
L-Lac  ( in XML )  (2)
  » L-lactate (XML) | L-lactic acid (XML)
LL-MN  ( in XML )  (2)
  » lupus-like membranous nephropathy (XML) | lumber longissimus muscle (XML)
L line  ( in XML )  (2)
  » low humoral immune reactivity (XML) | low line (XML)
LLAO  ( in XML )  (2)
  » lysosome-like acidic organelles (XML) | lower limb arterial occlusions (XML)
LLMA  ( in XML )  (2)
  » lower limb mechanical axis (XML)
LLEP  ( in XML )  (2)
  » long-latency evoked potentials (XML) | lower limb extensor power (XML)
LLS 2 and 3  ( in XML )  (2)
  » laparoscopic liver sectionectomy 2 and 3 (XML)
LL-Gp  ( in XML )  (2)
  » lentil-lectin semi-purified glycoprotein extract of T. solium (XML) | lentil-lectin purified glycoprotein (XML)
LLDLT  ( in XML )  (2)
  » liver living donor liver transplantation (XML) | low-level diode laser therapy (XML)
LLHF  ( in XML )  (2)
  » lowest lean/highest fat (XML) | lower level health facilities (XML)
LLPAD  ( in XML )  (2)
  » lower limb peripheral arterial disease (XML)
LLID  ( in XML )  (2)
  » LocusLink ID (XML)
LLVEF  ( in XML )  (2)
  » low left ventricular ejection fraction (XML)
LLSLHFY14  ( in XML )  (2)
  » Lactococcus lactis subsp. lactis HFY14 (XML)
LL-HN  ( in XML )  (2)
  » low-light and high-nitrogen (XML)
L-LCR  ( in XML )  (2)
  » L-lactate:ferricytochrome-c oxidoreductase (XML)
L-LDA  ( in XML )  (2)
  » labeled latent Dirichlet allocation (XML)
LLIG  ( in XML )  (2)
  » lower lumbar instability group (XML) | low-level intervention group (XML)
LLAMSS  ( in XML )  (2)
  » Lake Louise AMS score (XML) | Lake Louise Acute Mountain Sickness Score (XML)
LLVs  ( in XML )  (2)
  » light levels variations (XML) | lymphoid leukosis viruses (XML)
LLGI  ( in XML )  (2)
  » low level gamma irradiation (XML) | log-likelihood gain on intensity (XML)
LLC-GFP  ( in XML )  (2)
  » lung carcinoma cells constitutively expressing GFP (XML) | Lewis-lung carcinoma cells labeled with GFP (XML)
L-LDI  ( in XML )  (2)
  » L-Lysine ethyl ester diisocyanate (XML)
LLATSA  ( in XML )  (2)
  » left anterior transperitoneal submesocolic adrenalectomy (XML)
L. longipalpis  ( in XML )  (2)
  » Lutzomyia longipalpis (XML)
LLEBV  ( in XML )  (2)
  » lyssavirus, Lleida bat lyssavirus (XML) | Lleida bat lyssavirus (XML)
LLPF  ( in XML )  (2)
  » longissimus lumborum peak force (XML) | lateral leg perforator flap (XML)
LLNle  ( in XML )  (2)
  » leucine-leucin-norleucinal (XML) | Benzyloxicarbonyl-Leu-Leu-Nle-CHO (XML)
LLP-I  ( in XML )  (2)
  » lentiviral lytic peptide I (XML)
LL-14  ( in XML )  (2)
  » LKWLKKLLKWLKKL (XML) | 14-residue-long lysine-rich cationic antimicrobial peptide (XML)
LLoD  ( in XML )  (2)
  » leaf longitudinal diameter (XML) | low limit of detection (XML)
LLAGN  ( in XML )  (2)
  » low-luminosity active galactic nucleus (XML)
LLEE  ( in XML )  (2)
  » low-level exercise echocardiography (XML) | lotus leaf ethanol extract (XML)
LLROM  ( in XML )  (2)
  » Lower limb range of motion (XML)
LLRS-AIM  ( in XML )  (2)
  » Limb Lengthening and Reconstruction Society AIM (XML) | GOAL-LD scores with a measure of limb deformity complexity (XML)
L. LPMC  ( in XML )  (2)
  » left lateral premotor cortex (XML)
LLCN  ( in XML )  (2)
  » lyotropic liquid crystalline nanosystems (XML) | lncRNAlncRNA co-expression network (XML)
LLE/LTP  ( in XML )  (2)
  » liquid-liquid extraction with a low-temperature partition (XML)
LLUSD  ( in XML )  (2)
  » Loma Linda University School of Dentistry (XML)
LLL-STS  ( in XML )  (2)
  » lower limb loading during sit-to-stand (XML)
LLAN  ( in XML )  (2)
  » late left anterior negativity (XML)
LLVSs  ( in XML )  (2)
  » lower lobar vessels of the spleen (XML) | long-lasting voltage shifts (XML)
LLESs  ( in XML )  (2)
  » low-lying electronic states (XML) | low-lying excited states (XML)
LL-FAS  ( in XML )  (2)
  » Lower Limb-Function Assessment Scale (XML)
LLSPD-Net  ( in XML )  (2)
  » Low-Light Sparse Polarization Demosaicing Network (XML)
LLC-CM  ( in XML )  (2)
  » LLC-LN7-conditioned medium (XML)
LL-MACE  ( in XML )  (2)
  » low-load MACE (XML) | low-load metal-assisted catalytic etching (XML)
l-LTM  ( in XML )  (2)
  » late long-term (XML) | late long-term memory (XML)
L-LSGP  ( in XML )  (2)
  » large sialoglycoprotein of human lymphocytes (XML)
LLHFs  ( in XML )  (2)
  » lower level health care facilities (XML)
llmRNA  ( in XML )  (2)
  » leaderless mRNA (XML)
LL35  ( in XML )  (2)
  » Leech lectin 35 (XML) | lead length at 35 days (XML)
llmJOA  ( in XML )  (2)
  » lower limb mJOA (XML)
L. lactis subsp. lactis  ( in XML )  (2)
  » Lactococcus lactis subsp. lactis (XML)
LLREs  ( in XML )  (2)
  » lower limb rehabilitation exoskeletons (XML) | low-level radioactive effluents (XML)
LLFI-10  ( in XML )  (2)
  » Lower Limb Functional Index-10 (XML)
LLD-ACV  ( in XML )  (2)
  » delta-L-alpha-aminoadipyl-L-cysteinyl-D-valine (XML)
LLGL1  ( in XML )  (2)
  » lethal giant larvae homolog 1 (XML) | Lgl, Lgl1 (XML)
LLCGs  ( in XML )  (2)
  » lower lateral cartilaginous grafts (XML) | lower-limb compression garments (XML)
Llo  ( in XML )  (2)
  » L. longbeachae, endogenous SidC (XML) | Legionella longbeachae (XML)
LLaVA  ( in XML )  (2)
  » Large Language-and-Vision Assistant (XML)
LLET  ( in XML )  (2)
  » ligand-to-ligand ET (XML) | low linear energy transfer (XML)
L-LecRKs  ( in XML )  (2)
  » L-type LecRKs (XML) | lectin receptor-like kinases (XML)
l,l-TMAP  ( in XML )  (2)
  » N,N,N-trimethyl-l-alanyl-l-proline betaine (XML)
LLC-Luc  ( in XML )  (2)
  » Lewis lung carcinoma luciferase (XML) | LLC-luciferase (XML)
LLPS-PIESA  ( in XML )  (2)
  » liquid-liquid phase-separation-driven polymerization-induced electrostatic self-assembly (XML)
LLMUPR  ( in XML )  (2)
  » low-level mupirocin-resistant (XML)
LL-RT  ( in XML )  (2)
  » low-load resistance exercise (XML) | LL-BFR-RT (XML)
LLIRCT  ( in XML )  (2)
  » liquid-liquid interface recrystallization technique (XML)
LLWS  ( in XML )  (2)
  » Little League World Series (XML) | Live Long Walk Strong (XML)
l-LSM  ( in XML )  (2)
  » l-lysine semi-maleate (XML)
LLhP  ( in XML )  (2)
  » LacI DNA-binding domain/linker and the PurR regulatory domain (XML) | LacI/GalR homologues, we have created a chimeric protein (XML)
LLCRs  ( in XML )  (2)
  » lesion-to-liver contrast ratios (XML) | leadership line care rounds (XML)
lld-ACV  ( in XML )  (2)
  » delta-l-alpha-aminoadipoyl-l-cysteinyl-d-valine (XML)
LLVNS  ( in XML )  (2)
  » level left vagus nerve stimulation (XML) | low-level vagosympathetic nerve stimulation (XML)
L-LYC  ( in XML )  (2)
  » lycopene-loaded liposomes (XML) | lycopene liposomes (XML)
LL-SEP  ( in XML )  (2)
  » long latency somatosensory evoked potentials (XML)
LLTSA  ( in XML )  (2)
  » linear local tangent space alignment (XML)
l loop  ( in XML )  (2)
  » left-hand topology (XML)
LLLal  ( in XML )  (2)
  » Leu-Leu-Leu-aldehyde (XML) | Leu-Leu-Leu-al (XML)
LLBI  ( in XML )  (2)
  » lower limb burn injury (XML)
LLMOs  ( in XML )  (2)
  » layered lithium transition metal oxides (XML) | Layered, Li-rich Mn-based oxides (XML)
LLHV  ( in XML )  (2)
  » low-load high-velocity (XML)
LLVB  ( in XML )  (2)
  » large left ventricular branch (XML) | low lung volume breathing (XML)
LLT50  ( in XML )  (2)
  » lethal temperature to kill 50% of the population (XML) | lethal temperatures at 50% mortality (XML)
LLNMs  ( in XML )  (2)
  » Low-solubility, low-permeability natural medicines (XML) | lateral lymph node metastases (XML)
LLRa  ( in XML )  (2)
  » long-latency response amplitude (XML) | LLR amplitude (XML)
LLUNA  ( in XML )  (2)
  » Literate Language Use in Narrative Assessment (XML)
LLMV  ( in XML )  (2)
  » lower limb muscle volume (XML) | lowest levels of method validation (XML)
LLnV  ( in XML )  (2)
  » N-carbobenzoxy-L-leucyl-L-leucyl-L-norvalinal (XML)
LL37  ( in XML )  (2)
  » LL37-conjugated gold nanoparticles, LL37-Au NPs (XML) | cathelicidin-LL37 (XML)
LL-IRI  ( in XML )  (2)
  » Lower-limb ischemia-reperfusion injury (XML)
LL-CNN  ( in XML )  (2)
  » life-long learning segmentation CNN (XML) | lifelong learning-based convolutional neural network (XML)
LLML  ( in XML )  (2)
  » long lasting microbial larvicides (XML)
LLBWP  ( in XML )  (2)
  » LLBWP compared to HLBWP (XML) | low LBWP (XML)
LLNB  ( in XML )  (2)
  » low level narrow band (XML) | laparoscopic lymph node biopsy (XML)
LLAMAS  ( in XML )  (2)
  » low-latency adaptive optical mirror system (XML) | lickety-split ligand-affinity-based molecular angling system (XML)
LLDK  ( in XML )  (2)
  » lower lumbar degenerative kyphosis (XML) | LLDK group (XML)
LLQC  ( in XML )  (2)
  » lower limit of quantification (XML)
LLFD  ( in XML )  (2)
  » life-limiting fetal diagnosis (XML) | Late-Life Function and Disability (XML)
L,L-EC  ( in XML )  (2)
  » L,L-ethylenedicysteine (XML)
LLNI  ( in XML )  (2)
  » low-level neuroinflammation (XML)
LLPJ  ( in XML )  (2)
  » laparoscopic longitudinal pancreatojejunostomy (XML)
LLAPC  ( in XML )  (2)
  » log-linear age-period-cohort (XML)
LLC-MDR1  ( in XML )  (2)
  » Laboratories Cell Porcine Kidney 1 cells overexpressing MDR1 (XML) | LLC-PK1, and its transformant cells expressing human P-glycoprotein (XML)
LLJs  ( in XML )  (2)
  » low-level jets (XML)
LLSRS  ( in XML )  (2)
  » Lake Louise self-report score (XML)
LLF TB  ( in XML )  (2)
  » Lower lung field tuberculosis (XML) | Lower lung field TB (XML)
LLC-NPs  ( in XML )  (2)
  » lyotropic liquid crystal nanoparticles (XML) | low lipid core-nanoparticles (XML)
LLBF  ( in XML )  (2)
  » Layered Lightweight Blockchain Framework (XML) | left leg blood flow (XML)
llz  ( in XML )  (2)
  » lounge lizard (XML)
LLsME  ( in XML )  (2)
  » liquid-liquid semimicroextraction (XML)
LL-DAP  ( in XML )  (2)
  » LL-diaminopimelic acid (XML) | large LL-diaminopimelic acid (XML)
LL/HD  ( in XML )  (2)
  » low LV and high disability (XML) | lesion load/high disability group (XML)
LLIHNs  ( in XML )  (2)
  » long-lasting insecticidal hammock nets (XML)
LLVP  ( in XML )  (2)
  » left lateral ventricular preexcitation (XML) | lower limb vascular pain (XML)