Abbreviation List in Life Science - LL
The following abbreviations beginning with 'LL' are found in the Allie database (>=2, order of frequency). Search for one's corresponding long forms on Allie by clicking it.
LLMs ( in XML ) (7121)
» large language models (XML) | language models (XML) | lipid-laden macrophages (XML) | lipid-lowering medications (XML) | large-scale language models (XML) ...
LL ( in XML ) (5363)
» lumbar lordosis (XML) | longissimus lumborum (XML) | lower limb (XML) | lepromatous leprosy (XML) | low light (XML) ...
LLLT ( in XML ) (2551)
» low-level laser therapy (XML) | low-level laser treatment (XML) | low-level laser/light therapy (XML) | low reactive-level laser therapy (XML) | low-level lasers therapy (XML) ...
LLPS ( in XML ) (2239)
» liquid-liquid phase separation (XML) | low-load prolonged stretch (XML) | lower-limb paralysis simulator (XML) | LLPS-DRs (XML) | liquid-liquid phase-separated intermediate (XML) ...
LLM ( in XML ) (2010)
» large language model (XML) | lipid-lowering medication (XML) | leg lean mass (XML) | lipid-laden macrophages (XML) | Logic Learning Machine (XML) ...
LLC ( in XML ) (1930)
» Lewis lung carcinoma (XML) | Lewis lung cancer (XML) | lyotropic liquid crystal (XML) | lower lateral cartilage (XML) | Lake Louise criteria (XML) ...
LLD ( in XML ) (1921)
» leg length discrepancy (XML) | late-life depression (XML) | lower limit of detection (XML) | lipid-lowering drugs (XML) | left lateral decubitus (XML) ...
LLOQ ( in XML ) (1857)
» lower limit of quantification (XML) | lower LOQ (XML) | linearity, limit of quantification (XML) | limit of lower quantification (XML) | LLOQ value, i.e., C (XML) ...
LLE ( in XML ) (1527)
» liquid-liquid extraction (XML) | largest Lyapunov exponent (XML) | locally linear embedding (XML) | liquid-liquid equilibrium (XML) | loss of life expectancy (XML) ...
LLR ( in XML ) (1170)
» laparoscopic liver resection (XML) | log-likelihood ratio (XML) | long latency response (XML) | long-latency reflex (XML) | locally low-rank (XML) ...
LLT ( in XML ) (977)
» lipid-lowering therapy (XML) | lipid layer thickness (XML) | lipid-lowering treatment (XML) | liquid-liquid transition (XML) | lower lethal temperature (XML) ...
LLL ( in XML ) (933)
» late lumen loss (XML) | left lower lobe (XML) | low-level laser (XML) | lower limb lymphedema (XML) | lifelong learning (XML) ...
LLINs ( in XML ) (932)
» long-lasting insecticidal nets (XML) | long-lasting impregnated nets (XML) | long-lasting insecticidal mosquito nets (XML) | long-lasting insecticidal bednets impregnated with pyrethroid insecticides (XML) | long-lasting treated mosquito nets (XML) ...
LLS ( in XML ) (902)
» Lake Louise Score (XML) | laser light scattering (XML) | left lateral sectionectomy (XML) | left lateral segment (XML) | linear least squares (XML) ...
LLA ( in XML ) (643)
» lower limb amputation (XML) | lumbar lordosis angle (XML) | lower limit of autoregulation (XML) | lipid-lowering agents (XML) | linoleic acid (XML) ...
LLO ( in XML ) (620)
» listeriolysin O (XML) | lipid-linked oligosaccharide (XML) | laser lift-off (XML) | Li-rich layered oxide (XML) | lower limb orthosis (XML) ...
LLIF ( in XML ) (598)
» lateral lumbar interbody fusion (XML) | lumbar lateral interbody fusion (XML) | lateral lumbar transpsoas interbody fusion (XML) | lateral lumbar intervertebral fusion (XML) | lateral lumbar or thoracic interbody fusion (XML) ...
LLN ( in XML ) (587)
» lower limit of normal (XML) | lateral lymph node (XML) | limit of normal (XML) | lingual lymph node (XML) | lymphomatous lymph nodes (XML) ...
LLNA ( in XML ) (464)
» local lymph node assay (XML) | local lymph node (XML) | local lymph node assay: 5-bromo-2-deoxyuridine-flow cytometry method (XML) | local lymph node assay using 5-bromo-2-deoxyuridine (BrdU) with flow cytometry (XML) | LLNA modified by Daicel based on ATP content (XML) ...
LLP ( in XML ) (338)
» lateral locking plate (XML) | lower limb prosthesis (XML) | long-lasting potentiation (XML) | Liverpool Lung Project (XML) | late luteal phase (XML) ...
LLETZ ( in XML ) (331)
» large loop excision of the transformation zone (XML) | loop excision of the cervical transformation zone (XML) | Loop Electrosurgical Excision of the Transformation Zone (XML) | large loop excision of the TZ (XML) | limited-excision resulted in a substantially lower cone size (XML) ...
LLV ( in XML ) (314)
» low-level viremia (XML) | lymphoid leukosis virus (XML) | lean leg volume (XML) | liver lobe volume (XML) | lower limit of vulnerability (XML) ...
LLIN ( in XML ) (271)
» long-lasting insecticidal net (XML) | long-lasting impregnated nets (XML) | Long lasting impregnated mosquito net (XML) | successful.Long-lasting insecticidal nets (XML) | long-lasting treated bed nets (XML) ...
LLI ( in XML ) (232)
» leg length inequality (XML) | liquid-liquid interface (XML) | limiting longstanding illness (XML) | language-learning impairment (XML) | long-lived individuals (XML) ...
LLDPE ( in XML ) (219)
» linear low-density polyethylene (XML) | low-density polyethylene (XML) | Low-Linear Density Polyethylene (XML) | linear low-density PE (XML)
LLDAS ( in XML ) (212)
» lupus low disease activity state (XML) | Low Lupus Disease Activity State (XML) | LLDAS and DORIS favoured anifrolumab versus placebo (XML) | lupus low DAS (XML) | Lupus LDA State (XML) ...
LLCs ( in XML ) (207)
» lyotropic liquid crystals (XML) | life-limiting conditions (XML) | large luteal cells (XML) | lamellar liquid crystals (XML) | Lewis lung carcinoma cells (XML) ...
LLNM ( in XML ) (184)
» lateral lymph node metastasis (XML) | lateral LNM (XML) | lateral LN metastasis (XML) | LLN metastasis (XML)
LLND ( in XML ) (176)
» lateral lymph node dissection (XML) | LLN dissection (XML) | laparoscopic lymph node dissection (XML) | limited lymph node dissection (XML) | lateral LND (XML) ...
LLF ( in XML ) (168)
» Ligustri Lucidi Fructus (XML) | lung lavage fluid (XML) | lung lining fluid (XML) | lateral lingual foramen (XML) | leadership learning framework (XML) ...
LLOD ( in XML ) (166)
» lower limit of detection (XML) | lower detection limit (XML) | late-late onset disease (XML) | lower LOD limit (XML) | late-life onset depression (XML) ...
LLDs ( in XML ) (159)
» lipid-lowering drugs (XML) | leg length discrepancies (XML) | living liver donors (XML) | long-lasting depolarizations (XML) | low-level descriptors (XML) ...
L. lactis ( in XML ) (152)
» Lactococcus lactis (XML) | Lactococcus lactis subsp. lactis (XML) | Lactobacillus lactis (XML) | Lactococcuslactis subsp. cremoris (XML)
LLQ ( in XML ) (143)
» lower limit of quantification (XML) | left lower quadrant (XML) | Low Luminance Questionnaire (XML) | Lake Louise Questionnaire (XML) | lower limit of reliable quantification (XML) ...
LLRs ( in XML ) (137)
» long-latency reflexes (XML) | long-leg radiographs (XML) | laparoscopic liver resections (XML) | long-latency responses (XML) | large local reactions (XML) ...
LLs ( in XML ) (133)
» Landau levels (XML) | lower limbs (XML) | Living Labs (XML) | lowlanders (XML) | linear lesions (XML) ...
L-LTP ( in XML ) (133)
» late-phase long-term potentiation (XML) | late-phase LTP (XML) | late LTP (XML) | long-lasting long-term potentiation (XML) | long-lasting LTP (XML) ...
LLCT ( in XML ) (127)
» ligand-to-ligand charge transfer (XML) | low load compression testing (XML) | low-lying cerebellar tonsils (XML) | lung-to-lung circulation time (XML) | LLCT was the only independent predictor where VO(2peak) = 3.923-0.045 (XML) ...
L-LA ( in XML ) (126)
» L-lactide (XML) | L-lactic acid (XML) | liposomes with lipoic acid (XML) | low-dose Lindera aggregata (XML) | Limited lymphadenectomy (XML) ...
LLG ( in XML ) (113)
» Landau-Lifshitz-Gilbert (XML) | lipid layer grade (XML) | left liver graft (XML) | log-likelihood gain (XML) | Leucaena leucocephala galactomannan (XML) ...
LLMICs ( in XML ) (107)
» low- and lower-middle-income countries (XML) | lower middle income countries (XML)
LLLI ( in XML ) (99)
» low-level laser irradiation (XML) | La Leche League International (XML) | lower-left lateral incisor (XML) | lower-limb length inequality (XML) | lower limb lymphatic insufficiency (XML) ...
LLTs ( in XML ) (98)
» lipid-lowering therapies (XML) | Lower-Level Terms (XML) | lipid-lowering treatments (XML) | liquid-liquid transitions (XML) | Lipoblastoma-like tumors (XML) ...
LLOQs ( in XML ) (95)
» lower limits of quantification (XML) | low quantification limits (XML)
LLPCs ( in XML ) (94)
» long-lived plasma cells (XML) | long-lived PCs (XML) | long-lived, bone marrow-associated plasma cells (XML) | long-lived, immunoglobulin-secreting plasma cells (XML) | long-lived memory plasma cells (XML)
L-L ( in XML ) (87)
» liquid-liquid (XML) | leading edge-to-leading edge (XML) | low GL (XML) | low supply-low demand (XML) | latero-lateral (XML) ...
LLVA ( in XML ) (79)
» low-luminance visual acuity (XML) | low-luminance VA (XML) | Lower limb vascular access (XML) | low-luminance best-corrected visual acuity (XML)
LLB ( in XML ) (78)
» low-level blast (XML) | long leg braces (XML) | laparoscopic liver biopsy (XML) | lower lid blepharoplasty (XML) | laparoscopic lymph node biopsy (XML) ...
LLDN ( in XML ) (78)
» laparoscopic live donor nephrectomy (XML) | laparoscopic LDN (XML) | left LDN (XML) | Lateral lymph node dissection (XML) | low latency deterministic network (XML) ...
LLOs ( in XML ) (76)
» lipid-linked oligosaccharides (XML) | Li-rich layered oxides (XML) | Lithium-rich layered oxides (XML) | Li-rich layered oxides cathodes (XML) | Lower limb orthoses (XML) ...
LLH ( in XML ) (75)
» laparoscopic left hemihepatectomy (XML) | left laryngeal hemiplegia (XML) | long loops of Henle (XML) | low-level hemolysis (XML) | long-lasting hyperpolarization (XML) ...
LLNs ( in XML ) (74)
» lateral lymph nodes (XML) | lower limits of normal (XML) | Low-Power and Lossy Networks (XML) | lingual lymph nodes (XML) | Lipid-like nanoparticles (XML) ...
LLME ( in XML ) (74)
» liquid-liquid microextraction (XML) | L-leucyl-L-leucine methyl ester (XML) | LeuLeuOMe (XML) | L-leucine methyl ester (XML) | liquid-liquid membrane extraction (XML) ...
LLFS ( in XML ) (71)
» Long Life Family Study (XML) | lower limit of fatigue strength (XML) | low lung function subgroup (XML)
LLFDI ( in XML ) (67)
» Late-Life Function and Disability Instrument (XML) | late-life function and disability (XML) | Late-life Disability and Function Index (XML)
LLCP ( in XML ) (66)
» liquid-liquid critical point (XML) | lamella of the cribriform plate (XML) | lateral lamella of cribriform plate (XML) | LL critical point (XML) | LLC precursor (XML) ...
LLPs ( in XML ) (64)
» long-lived proteins (XML) | long-lived particles (XML) | lipoprotein-like particles (XML) | lysozyme-like proteins (XML) | lipid layer patterns (XML) ...
LLAs ( in XML ) (61)
» lower limb amputations (XML) | lipid-lowering agents (XML) | lower limb amputees (XML) | lateral lenticulostriate arteries (XML) | lower limb arteries (XML) ...
LLNL ( in XML ) (58)
» Lawrence Livermore National Laboratory (XML)
L-Lys ( in XML ) (55)
» L-lysine (XML) | L-lysine hydrochloride (XML)
LLPT ( in XML ) (53)
» liquid-liquid phase transition (XML) | Left Leg Proprioception Test (XML)
LLPC ( in XML ) (52)
» long-lived plasma cells (XML) | liquid-liquid partition chromatography (XML) | left lateral parietal cortex (XML) | light-limited photocurrent density (XML) | liquid-liquid partition chromatography in aqueous two-phase systems (XML) ...
LLIs ( in XML ) (50)
» long-lived individuals (XML) | life-limiting illnesses (XML) | Leg length inequalities (XML) | lower-limb injuries (XML) | language-based learning impairments (XML) ...
LLMI ( in XML ) (50)
» lipid-laden macrophage index (XML) | lower limit of the measuring interval (XML) | low- and lower middle-income (XML) | Left lateral mitral isthmus (XML) | lower limb motor imagery (XML) ...
LL-BFR ( in XML ) (45)
» low-load blood flow restriction (XML) | low-load resistance training with blood flow restriction (XML) | low-load BFR (XML) | low-load exercise with blood-flow restriction (XML) | low-load BFR resistance exercise (XML) ...
L-LDH ( in XML ) (45)
» L-lactate dehydrogenase (XML) | LDH-like (XML) | L-lactic dehydrogenase (XML)
LLSM ( in XML ) (43)
» lattice light-sheet microscopy (XML) | linear-linear sire-maternal grandsire (XML) | linear limited sampling model (XML) | Life Log Sharing Model (XML) | Laparoscopic lateral suspension with mesh (XML)
LLW ( in XML ) (41)
» low-level radioactive waste (XML) | low level waste (XML) | Landrace-Large White (XML) | landfill leachate wastewater (XML) | Lives Lived Well (XML) ...
l-LV ( in XML ) (40)
» l-leucovorin (XML) | levofolinate (XML) | levofolinate calcium (XML) | levoleucovorin (XML)
LLDS ( in XML ) (37)
» Lifelines Diet Score (XML) | late-life depressive symptoms (XML) | Local Lift Dependence Scale (XML) | laser-light diffraction spectroscopy (XML) | lower level of depressive symptoms (XML) ...
LLLS ( in XML ) (36)
» laparoscopic left lateral sectionectomy (XML) | liver left lateral section (XML) | level of cord injury or lesional sector (XML) | local linearized least squares (XML) | low-level laser stimulation (XML) ...
LLAEP ( in XML ) (36)
» long-latency auditory evoked potentials (XML) | long-latency auditory event-related potential (XML) | Long Latency Evoked Potentials (XML) | long latency AEPs (XML) | long latency AEP components (XML)
LLRT ( in XML ) (36)
» low-load resistance training (XML) | leg lateral reach test (XML) | low-level resistance and tolerance (XML) | Linear linking for related traits (XML) | lower-limb robot training (XML) ...
LLT1 ( in XML ) (35)
» lectin-like transcript 1 (XML) | LLT1TC (XML) | CD161-Lectin-like Transcript 1 (XML)
LLTS ( in XML ) (32)
» Low-level tragus stimulation (XML) | low-level transcutaneous electrical stimulation (XML) | low-level, transcutaneous stimulation of vagus nerve at the tragus (XML) | landfill leachate treatment station (XML) | liquid layer transport speed (XML) ...
LLU ( in XML ) (32)
» Loma Linda University (XML) | leukocyte ultrafiltrate (XML) | lower leg ulcers (XML) | low-loop ureterostomy (XML) | long-lasting UC (XML) ...
LLAR ( in XML ) (30)
» laparoscopic low anterior resection (XML) | low laparoscopic anterior resection (XML) | left LAR (XML) | MI-LAR and OLAR and between laparoscopic (XML) | laparoscopic LAR (XML) ...
L-Leu ( in XML ) (29)
» L-leucine (XML) | L-leucine polypeptides (XML) | L-Leu-Leu (XML)
LLIE ( in XML ) (28)
» low-light image enhancement (XML)
LLST ( in XML ) (28)
» limitation of life-sustaining treatment (XML) | limitation of life support treatment (XML) | left lateral segment liver transplantation (XML) | laser light scattering techniques (XML) | lightweight, strong and tough cement-based material (XML) ...
LLSs ( in XML ) (27)
» long-lived states (XML) | long-lived spin states (XML) | liquid-like surfaces (XML) | Lake Louise scores (XML) | leaflike structures (XML) ...
l-LA ( in XML ) (27)
» l-lactide (XML) | l-lactate (XML)
LLSCC ( in XML ) (27)
» lower lip squamous cell carcinoma (XML) | lower lip SCC (XML)
LLLs ( in XML ) (26)
» lumenless leads (XML) | low-level lasers (XML) | lumen-less pacing leads (XML) | liquid-like layers (XML) | longitudinal length of the lesions (XML) ...
LLSS ( in XML ) (25)
» Lake Louise Scoring System (XML) | long-lived spin states (XML) | Lake Louise Symptom Score (XML) | laparoscopic liver skills scale (XML) | long-lasting subconductance states (XML) ...
LLAC ( in XML ) (25)
» lower limb arterial calcification (XML) | lupus-like anticoagulant (XML) | lingual augmented corticotomy (XML) | L-lactic acid concentration (XML) | liquid-liquid extraction followed by acidic hydrolysis (XML)
LLPDD ( in XML ) (25)
» late luteal phase dysphoric disorder (XML)
LLEs ( in XML ) (24)
» lower limb exoskeletons (XML) | largest Lyapunov exponents (XML) | lower limb events (XML) | LINE1-like elements (XML) | Lower limb assistive exoskeletons (XML) ...
LLMS ( in XML ) (24)
» lower-limb muscle strength (XML) | long lateral mass screws (XML) | Lower Limb Model for Safety (XML) | laparoscopic lateral mesh suspension (XML) | laryngeal leiomyosarcoma (XML) ...
LLTI ( in XML ) (23)
» limiting long-term illness (XML) | l-lysine triisocyanate (XML) | long-standing illness (XML) | lipid-lowering therapy intensification (XML) | Lower limb transient ischemia (XML)
LLPA ( in XML ) (22)
» low light-intensity physical activity (XML) | Low-level physical activity (XML) | left lateral para-aortic (XML) | low light-intensity PA (XML) | low physical activity (XML) ...
LLCI ( in XML ) (22)
» lower limb critical ischaemia (XML) | lower limit confidence interval (XML) | lower limb comfort index (XML) | lower limits of the CI (XML)
LLnL ( in XML ) (22)
» N-acetyl-L-leucyl-L-leucyl-L-norleucinal (XML) | N-acetyl-leucyl-norleucinal (XML)
LLCA ( in XML ) (22)
» longitudinal latent class analysis (XML) | lower limit of cerebral autoregulation (XML) | Loneliness Scale for Children and Adolescents (XML) | lower limit of CA (XML) | last Legionellales common ancestor (XML) ...
LLDI ( in XML ) (21)
» Late Life Disability Instrument (XML) | Late Life Disability Index (XML) | Late Life Function and Disability Instrument (XML) | labiolingual dysfunction index (XML) | L-lysine diisocyanate (XML)
LLIS ( in XML ) (21)
» Lymphedema Life Impact Scale (XML) | Long-lasting insecticidal net screens (XML)
LLOV ( in XML ) (21)
» Lloviu virus (XML) | Lloviu cuevavirus (XML)
LLaMA ( in XML ) (20)
» Large Language Model Meta AI (XML) | Language Learning and Meaning Acquisition (XML) | Large Language Model Architecture (XML) | LLM-based approach (XML)
LLFI ( in XML ) (20)
» Lower Limb Functional Index (XML) | low LFI (XML) | Late Life Function Instrument (XML) | LFI score: low (XML)
LL-37 ( in XML ) (20)
» leucine-leucine-37 (XML) | [LL-37, 37 aa] (XML) | leucin-leucin-37 (XML) | LL-37 peptide (XML)
LLDP ( in XML ) (19)
» left lateral decubitus position (XML) | liquid-liquid displacement porometry (XML) | link-layer discovery protocol (XML) | lateral laparoscopic distal pancreatectomy (XML) | Lateral lumbar disc prosthesis (XML)
LLPM ( in XML ) (19)
» layered learning practice model (XML) | leadless pacemaker (XML) | Leadless pacemakers (XML) | linear length of a positive margin (XML)
LLLME ( in XML ) (19)
» liquid-liquid-liquid microextraction (XML)
LLAS ( in XML ) (19)
» Lower Limb Assessment Score (XML) | lower limb assessment scale (XML) | lower limb atherosclerosis (XML) | lumbar lordosis assistive support (XML) | Lower limb arterial stenosis (XML) ...
LLITNs ( in XML ) (19)
» long-lasting insecticide-treated nets (XML) | long-lasting-insecticide-treated bed nets (XML)
LLSVPs ( in XML ) (19)
» large low-shear-velocity provinces (XML) | large low-seismic-velocity provinces (XML)
LLIP ( in XML ) (19)
» liquid-liquid interfacial precipitation (XML) | Long Lead Initial pulse (XML)
LLCS ( in XML ) (19)
» Lower Limb Core Scale (XML) | lower limb compartment syndrome (XML) | Longitudinal and Life Course Studies (XML) | Lake Louise Clinical score (XML) | Lymphoepithelioma-like carcinoma of the skin (XML) ...
LL-VNS ( in XML ) (18)
» low-level vagus nerve stimulation (XML) | low-level vagosympathetic stimulation (XML) | low-level VNS (XML)
LLHT ( in XML ) (18)
» ligand-to-ligand hydrogen transfer (XML) | ligand-to-ligand H-transfer (XML)
LLSAN ( in XML ) (18)
» levator labii superioris alaeque nasi (XML) | labii superioris alaeque nasi muscle (XML) | LLS alaeque nasi (XML)
LLMIC ( in XML ) (18)
» low and lower-middle income countries (XML) | lower middle income countries (XML) | low and lower middle income (XML)
LLAT ( in XML ) (17)
» left lateral (XML) | lateral from the left side to the right side (XML)
l-Lys ( in XML ) (17)
» l-lysine (XML)
ll ( in XML ) (17)
» l allele homozygotes (XML) | limbless (XML) | littleleaf (XML) | l l $(epsilon)_ (XML) | loop lengths (XML) ...
LLTP ( in XML ) (17)
» large lipid transfer protein (XML) | landfill leachate treatment plant (XML) | late-stage LTP (XML)
Ll ( in XML ) (17)
» longissimus lumborum (XML) | labeling index (XML) | Loa loa (XML) | Locator light retention (XML) | Lophius litulon (XML) ...
LLTM ( in XML ) (16)
» linear logistic test model (XML) | leg lean tissue mass (XML) | loss of lean tissue mass (XML) | long-lasting long-term memory (XML) | Late Lutetian Thermal Maximum (XML) ...
LLDH ( in XML ) (16)
» lower lumbar disc herniation (XML) | laparoscopic living donor hepatectomy (XML) | living liver donor hepatectomy (XML) | lateral living donor hepatectomy (XML)
LLRW ( in XML ) (16)
» low-level radioactive waste (XML) | low-level radioactive laboratory waste (XML) | low-level radioactive liquid waste (XML)
LLSR ( in XML ) (16)
» long-latency stretch reflex (XML) | linear least squares regression (XML) | long latency stretch response (XML) | local laparotomic stomal reconstruction (XML) | Lake Louise Self-report Score (XML) ...
LLRE ( in XML ) (16)
» low-load resistance exercise (XML) | liquid-liquid refining extraction (XML) | late light response element (XML) | low-level radioactive effluents (XML)
LLSI ( in XML ) (15)
» limiting long-standing illness (XML) | limiting long-standing illness or disability (XML) | low levels of SIVmne infection (XML) | Lyme-Like Syndromic Illness (XML) | Local Latent Semantic Indexing (XML) ...
LLSIR ( in XML ) (15)
» lung-to-liver signal intensity ratio (XML) | lung/liver SIR (XML)
LLTO ( in XML ) (15)
» lithium lanthanum titanium oxide (XML) | Li3xLa2/3-xTiO3 (XML) | lithium lanthanum titanate, La2/3-xLi3xTiO3 (XML) | Li-La-Ti-O (XML) | Li(3x)La(2/3-x)TiO3 (XML) ...
LLHR ( in XML ) (15)
» low-load-high-repetitions (XML) | linear-linear homologous recombination (XML) | linear homologous recombination-mediated recombineering (XML) | leg-length-to-height ratio (XML) | low-load, higher-repetition training (XML) ...
LLJ ( in XML ) (15)
» low-level jet (XML) | latero-lateral joint (XML) | leaves of L. japonica (XML) | laterale-jeffersonianum (XML)
LLDA ( in XML ) (15)
» Local Linear Discriminant Analysis (XML) | low level disease activity (XML) | local LDA (XML) | local linear discrimination analysis (XML) | laser light diffusing area (XML) ...
LLMD ( in XML ) (15)
» late-life major depression (XML) | late-life major depressive disorder (XML) | late-life mortality deceleration (XML) | late-life mood disorders (XML) | Lyme-literate medical doctor (XML) ...
LLBFR ( in XML ) (14)
» low-load blood flow restriction (XML) | Low-load resistance exercise with blood flow restriction (XML) | LL with blood flow restriction (XML) | low-load exercise with BFR (XML) | low load training with BFR (XML)
LLCR ( in XML ) (14)
» lifetime lung cancer risk (XML) | laparoscopic left-sided colon resection (XML) | Lower lateral cartilage repositioning (XML) | liver-to-lesion contrast ratio (XML) | liver metastases and colorectal cancer (XML) ...
LLE-LTP ( in XML ) (14)
» liquid-liquid extraction with low temperature purification (XML)
LL'CT ( in XML ) (14)
» ligand-to-ligand charge transfer (XML) | LPtL', reveal charge-separated dichalcogenolene diimine charge-transfer (XML)
LLC-PK1 ( in XML ) (14)
» Lilly Laboratories Culture-Porcine Kidney 1 (XML) | Lewis lung carcinoma-porcine kidney-1 (XML) | Laboratories cell-porcine kidney 1 epithelial cells (XML) | LLC-Pig Kidney 1 (XML)
LLAEPs ( in XML ) (14)
» long latency auditory evoked potentials (XML)
LLCER ( in XML ) (13)
» lesion-to-liver contrast enhancement ratio (XML) | liver-to-lesion contrast enhancement ratio (XML)
LLRL ( in XML ) (13)
» low-level red light (XML) | low-level red laser (XML) | location-guided lesion representation learning method (XML)
LLIR ( in XML ) (13)
» Look-Locker inversion recovery (XML) | linearized local impulse response (XML) | laminin-like immunoreactivity (XML) | lectin-like immunoreceptor (XML) | liquid/liquid interfacial route (XML) ...
LLUMC ( in XML ) (12)
» Loma Linda University Medical Center (XML)
LLk ( in XML ) (12)
» low likelihood (XML)
LLRP ( in XML ) (12)
» lower limb rehabilitation protocol (XML) | lower leg radiating pain (XML) | long-lasting refractory period (XML) | lower Liaohe River Plain (XML) | lower limb radicular pain (XML) ...
LL-BFRT ( in XML ) (12)
» low-load blood flow restriction training (XML) | low-load resistance training combined with blood flow restriction (XML) | Low-load blood flow restriction strength training (XML)
LLITN ( in XML ) (12)
» long-lasting insecticide-treated net (XML) | long-lasting insecticidal net (XML) | long-lasting insecticide treated mosquito nets (XML)
LLCZ ( in XML ) (12)
» luliconazole (XML)
LLUH ( in XML ) (12)
» Loma Linda University Health (XML)
LLAD ( in XML ) (12)
» lower limb atherosclerosis disease (XML) | lower limb arterial disease (XML) | late-life anxiety disorder (XML) | late-life anxious depression (XML) | Luer-Lok Access Device (XML) ...
LLCPS ( in XML ) (11)
» liquid-liquid crystalline phase separation (XML)
l-Leu ( in XML ) (11)
» l-leucine (XML)
LLRA ( in XML ) (11)
» low lateral right atrium (XML) | Logistic Model with Relaxed Assumptions (XML) | low lateral RA (XML) | low-luminance binocular reading acuity (XML)
LLINEUP ( in XML ) (11)
» LLIN Evaluation in Uganda Project (XML) | Long-Lasting Insecticidal Net Evaluation in Uganda Project (XML)
LLLD ( in XML ) (11)
» lower-limb length discrepancy (XML) | left lateral lobe duct (XML) | lobar lung living-donors (XML) | localized-liquid-liquid-diffusion (XML) | long-label long-delay (XML) ...
LLTL ( in XML ) (11)
» live low-train low (XML) | living low-training low (XML) | living in normoxia with no additional maximal-intensity exercise (XML) | level with regular training only (XML)
LLZO ( in XML ) (10)
» lithium lanthanum zirconium oxide (XML) | lithium lanthanum zirconate (XML) | Li7-xLa3-aZr2-bO12 (XML) | Li-La-zirconate (XML) | Li7 La3 Zr2 O12-d (XML)
L-LR ( in XML ) (10)
» L-isomer only (XML) | L-lactated Ringer's (XML) | LLS, LH, RH (XML) | Leptin-Leptin receptor (XML) | L-isomer of lactate (XML) ...
L-LCNEC ( in XML ) (10)
» Lung large cell neuroendocrine carcinoma (XML) | large-cell neuroendocrine carcinoma of the lung (XML) | lung LCNEC (XML)
LLRS ( in XML ) (10)
» Limb Lengthening and Reconstruction Society (XML) | lumbar lateral recess stenosis (XML) | low-level radioactive samples (XML) | locally low-rank and sparsity (XML) | Large Lakes Research Station (XML) ...
LLBA ( in XML ) (10)
» Linguistics and Language Behavior Abstracts (XML) | load in bronchoalveolar lavage fluid (XML)
LLRR ( in XML ) (10)
» learned low-rank representation (XML) | Laplacian regularized Low-Rank Representation (XML) | lower limb rehabilitation robot (XML) | Lateral Labyrinthine Righting Reaction (XML) | latent low-rank representation referred (XML) ...
LLSPR ( in XML ) (10)
» longitudinal localized surface plasmon resonance (XML)
LLOA ( in XML ) (10)
» lower limb osteoarthritis (XML) | Laparoscopic lysis of adhesions (XML) | lower lateral orbital angle (XML) | lower limit of agreement (XML)
LL2 ( in XML ) (9)
» 131I-labelled anti-CD22 MAb (XML) | 131I-labeled anti-CD22 monoclonal antibody (XML) | LICR-LON-HMy2 (XML) | LHW-LIKE 2 (XML) | Lewis lung carcinoma 2 (XML) ...
l-LNvs ( in XML ) (9)
» large ventrolateral neurons (XML) | large LNvs (XML) | large lateral-ventral neurons (XML)
L-lep ( in XML ) (9)
» lepromatous leprosy (XML)
LLAM ( in XML ) (9)
» lipid-laden alveolar macrophages (XML) | linear-linear animal (XML) | lipid-laden macrophage (XML) | lesion localised attention module (XML)
LLTPs ( in XML ) (9)
» large lipid transfer proteins (XML) | landfill leachate treatment plants (XML) | Large lipid transfer proteins (XML)
LLBs ( in XML ) (9)
» Leaderless bacteriocins (XML) | Lidocaine-Loaded Bands (XML) | Lamellar bodies (XML) | Lanthanide Luminescent Bioprobes (XML) | liquid lithium batteries (XML) ...
LLFC ( in XML ) (9)
» life-limiting fetal condition (XML) | liver fat (LFC) after calving in low (XML) | low liver fat content (XML)
LLCD ( in XML ) (9)
» large liver cell dysplasia (XML) | liquid low-calorie diet program (XML) | Leadership Learning and Career Development (XML) | Liver cell dysplasia of large (XML)
LLMDA ( in XML ) (9)
» Lawrence Livermore Microbial Detection Array (XML)
LL-TS ( in XML ) (9)
» low-level tragus stimulation (XML)
LLK ( in XML ) (8)
» Landau-Lifshitz-Kittel (XML) | Laser Lok (XML) | lung/liver/kidney (XML) | likelihood (XML) | likelihood of CAD (XML) ...
LLNR ( in XML ) (8)
» lateral lymph node recurrence (XML) | lateral lymph nodes ratio (XML) | lateral-compartment LNR (XML)
LLA-CL ( in XML ) (8)
» CIF-loaded fibers made solely of P (XML) | (l-lactic acid-co--caprolactone) P (XML) | loading with the Wnt signal pathway inhibitor ICG-001, the Collagen/P (XML) | Lichtenstein inguinal hernia repair using electrospun P (XML) | loose and porous structure of the electrospun collagen/P (XML) ...
LLFR ( in XML ) (8)
» long latency flexor reflex (XML) | lunate-lunate facet ratio (XML) | low-level fosfomycin resistance (XML) | long-lasting facilitation of these reflexes (XML) | long-latency feedback response (XML) ...
LLSF ( in XML ) (8)
» linear least squares fitting (XML) | Linear Least Squares Fit (XML) | large Laplacian spatial filter (XML) | linear least-squares fitting method (XML)
L-LPS ( in XML ) (8)
» leptospiral lipopolysaccharide (XML) | low-dose LPS (XML) | Leishmania lipopolysaccharide (XML)
LLCH ( in XML ) (8)
» low level continuous heat (XML) | localized Langerhans cell histiocytosis (XML) | localised LCH (XML) | Landfill leachate (XML) | Langerhans cell histiocytosis (XML)
LLBNs ( in XML ) (8)
» long-lead burst neurons (XML)
LLLA ( in XML ) (8)
» Low-level laser acupuncture (XML) | left lower lobe atelectasis (XML) | lower limb loading ability (XML) | lower lumbar lordosis angle (XML)
LL3 ( in XML ) (8)
» LITAF-like 3 (XML) | LHW-LIKE 3 (XML) | late L3 (XML) | LUX-Lung 3 (XML) | lipopolysaccharide-induced tumor necrosis factor-alpha transcription factor 3 (XML) ...
LLCNPs ( in XML ) (8)
» lyotropic liquid crystalline nanoparticles (XML)
LLE-GC-MS ( in XML ) (8)
» liquid-liquid extraction-gas chromatography-mass spectrometry (XML)
LLRC ( in XML ) (8)
» Latino legal residents/citizens (XML) | limb-loss rehabilitation continuum (XML) | Locally Linear Representation-based Classification (XML) | limb loss rehabilitation continuum framework (XML) | legal Latino residents/citizens (XML) ...
LL-TK ( in XML ) (8)
» lumbar lordosis minus thoracic kyphosis (XML) | LL minus TK (XML)
LLES ( in XML ) (8)
» lower lumbar erector spinae (XML) | lower limb exoskeleton (XML) | lower limb explosive strength (XML) | low-lying excited states (XML) | low-lying metal-centered electronic states (XML) ...
LLKS ( in XML ) (8)
» Lymphangioma-like Kaposi's sarcoma (XML) | lymphangioma-like KS (XML)
LLEC ( in XML ) (7)
» long-lived effector cells (XML) | Landfill leachate evaporation concentrate (XML) | Leptomeningeal Lymphatic Endothelial Cells (XML) | L,L, ethylenedicysteine (XML) | lower lip epidermoid carcinoma (XML) ...
lly ( in XML ) (7)
» legiolysin (XML) | legiolysin gene (XML) | laboratory, legiolysin (XML)
LLODs ( in XML ) (7)
» lower limits of detection (XML)
LLMB ( in XML ) (7)
» low-lying muscle belly (XML) | lower limb motor blocks (XML) | Low-lying peroneus brevis muscle belly (XML) | lean lithium metal battery (XML)
LLOM ( in XML ) (7)
» lower-limb osteomyelitis (XML) | lower lip oral mucosa (XML) | low-level LOM (XML) | Leu-Leu-O-methyl (XML)
LLSQ ( in XML ) (7)
» linear least-squares (XML) | Lake Louise Score Questionnaire (XML)
LLTC ( in XML ) (7)
» lower-level trauma centers (XML) | lateral line trunk canal (XML) | laparoscopic Ligamentum Teres Cardiopexy (XML) | lower limb trauma coordinator (XML) | line or a tissue culture-adapted cell line (XML)
L-L SUV R ( in XML ) (7)
» lesion to liver SUVmax ratio (XML)
LLPTs ( in XML ) (7)
» liquid-liquid phase transitions (XML)
LLVV ( in XML ) (7)
» lower limb varicose veins (XML)
LLFs ( in XML ) (7)
» lower limb fractures (XML) | lateral LFs (XML) | line-like features (XML) | lipofuscin-like fluorophores (XML) | low lumbar fractures (XML) ...
LLOS ( in XML ) (7)
» long length of stay (XML) | lower limb orthoplastic surgery (XML) | Lower Leg Outcome Survey (XML) | liver transplantation (XML)
LLGR ( in XML ) (7)
» lower leg growth rate (XML) | Lich-Gregoir ureteral reimplantation (XML)
LLC-PK ( in XML ) (7)
» LLC porcine kidney (XML) | Lily Laboratory Culture, Porcine Kidney (XML)
LLZTO ( in XML ) (7)
» PVDF-HFP-LiClO4-Li6.4La3Zr1.4Ta0.6O12 (XML) | lanthanum zirconium tantalate (XML) | lithium lanthanum zirconate (XML) | lithium lanthanum zirconium oxide (XML) | LiLaZrTaO (XML) ...
LLSA ( in XML ) (7)
» low-dose low-specific-gravity spinal anesthesia (XML) | local linear scaling approximation (XML) | lower lobe segmental artery (XML) | low-lethality suicide attempts (XML) | Lifelong Learning and Self-assessment (XML) ...
LLDC ( in XML ) (7)
» Langerhans-like dendritic cells (XML) | Langerhans-like DC (XML) | LC-like dendritic cells (XML) | lower limit of detectable concentration (XML) | large low-density cell (XML) ...
LLHA ( in XML ) (7)
» lower lingual holding arch (XML)
LLMC ( in XML ) (7)
» landfill leachate membrane concentrate (XML) | liquid-liquid membrane contactor (XML) | lumbar lordosis matched correction (XML) | lipid-laden multilocular cells (XML)
LLVPs ( in XML ) (7)
» large low-velocity provinces (XML) | lower limb vascular procedures (XML)
LLLV ( in XML ) (7)
» lower leg length velocity (XML) | low-level LLV (XML) | LLL velocity (XML)
LLy ( in XML ) (7)
» lymphoblastic lymphoma (XML)
LLCPs ( in XML ) (7)
» liquid-liquid critical points (XML) | Luminescent liquid crystalline polymers (XML) | long-lived cartilage progenitors (XML) | Lyotropic liquid crystalline phases (XML) | linear liquid crystal polymers (XML) ...
LLPMs ( in XML ) (6)
» leadless pacemakers (XML) | leadless cardiac pacemakers (XML)
LLLR ( in XML ) (6)
» low-level laser radiation (XML) | laparoscopic limited liver resections (XML) | lateral segment liver resection (XML)
LLTH ( in XML ) (6)
» live low-train high (XML) | living-low and training-high (XML) | living low-training high (XML)
LLER ( in XML ) (6)
» position-lower limb external rotation (XML) | lowlevel of experience region (XML) | least evolutionary resistance (XML) | low level electromagnetic radiation (XML) | Lost Life Expectancy Rate (XML)
LL1 ( in XML ) (6)
» LHW-LIKE 1 (XML) | L1210 murine leukemia cells (XML) | Longlin 1 (XML) | LOTUS LEAF 1 (XML) | lower limb pattern 1 (XML) ...
LL-CBS ( in XML ) (6)
» low-level carotid baroreceptor stimulation (XML) | low-level CBS (XML)
l-LDH ( in XML ) (6)
» l-lactate dehydrogenase (XML)
LLNAs ( in XML ) (6)
» local lymph node assays (XML)
LLCC ( in XML ) (6)
» Lewis lung carcinoma cells (XML) | Large liver cell changes (XML) | life-long cardiac care (XML) | lifelong chronic conditions (XML)
ll-DAP ( in XML ) (6)
» ll-diaminopimelic acid (XML) | l-lysine diaminopimelic acid (XML)
LLX ( in XML ) (6)
» liquid-liquid extraction (XML) | leader-leader exchange (XML)
LLDDs ( in XML ) (6)
» lethal lung developmental disorders (XML)
LLPP ( in XML ) (6)
» left lateroportal process (XML) | lymph lipid precursor pool (XML) | LPP in a linear distribution (XML)
LLPUs ( in XML ) (6)
» lower limb prosthesis users (XML)
LLG1 ( in XML ) (6)
» LORELEI-LIKE GPI-ANCHORED PROTEIN1 (XML) | LRE-like GPI-AP1 (XML) | Lorelei-Like Glycoprotein 1 (XML) | (LRE)-LIKE GLYCOSYLPHOSPHATIDYLINOSITOL (GPI)-ANCHORED PROTEIN 1 (XML)
LLaVA ( in XML ) (6)
» Large Language and Vision Assistant (XML)
LLC1 ( in XML ) (6)
» Lewis lung carcinoma 1 (XML) | Lewis lung cancer 1 (XML)
L-LMC ( in XML ) (6)
» lumbar lateral motor column (XML)
LLNP ( in XML ) (6)
» local lymph node proliferation assay (XML) | lower leg negative pressure (XML) | Lachua National Park (XML) | large-sized lipid nanoparticle (XML) | LiLa(1-x)Nd(x)(PO(3))(4) (XML)
LLAPs ( in XML ) (6)
» Legionella-like amoebal pathogens (XML)
LLGP ( in XML ) (6)
» lentil lectin purified glycoprotein (XML) | lentil-lectin-purified glycoproteins from T. solium Ag (XML) | lentil lectin-bound glycoproteins (XML)
LLRM ( in XML ) (6)
» Laplacian-likelihood-ratio method (XML) | lamina and ligament repair model (XML) | LASSO logistic regression model (XML) | Low Level of Response Model (XML) | Lasso-Logistics prediction model (XML)
LLVR ( in XML ) (6)
» low-level viral rebound (XML) | lens thickness, real vitreous chamber depth and retinal thickness (XML) | left renal vein (XML) | Late LVR (XML) | Laparoscopic low ventral rectocolpopexy (XML)
LLCa ( in XML ) (6)
» Lewis lung carcinoma (XML) | Lewis Lung carcinoma cells (XML)
LLY ( in XML ) (6)
» lectinolysin (XML) | Leu-Leu-Tyr (XML) | lost life-years (XML) | LandraceLandraceYorkshire (XML)
LL-III ( in XML ) (6)
» Lasioglossin-III (XML)
LLTE ( in XML ) (5)
» lower leg trajectory error (XML) | listening and treatment explanations (XML)
LLAF ( in XML ) (5)
» lipofuscin-like autofluorescence (XML) | long leg alignment films (XML)
LLWR ( in XML ) (5)
» least limiting water range (XML)
LLE-SPE ( in XML ) (5)
» liquid-liquid extraction followed by solid-phase extraction (XML)
LLCNs ( in XML ) (5)
» lyotropic liquid crystalline nanoparticles (XML)
LLPL ( in XML ) (5)
» LCAT-like lysophospholipase (XML) | lower-leg proprioceptive loss (XML) | limited laparoscopic pelvic lymphadenectomy (XML) | acyltransferase-like lysophospholipase (XML)
LLCPA ( in XML ) (5)
» lateral lamella-cribriform plate angle (XML) | lateral lamella CP angle (XML) | lateral lamella and cribriform plate (XML) | lamella and the cribriform plate (XML)
LldD ( in XML ) (5)
» L-lactate dehydrogenase (XML)
L-L IBR ( in XML ) (5)
» liquid-liquid interface bioreactor (XML)
LLLH ( in XML ) (5)
» laparoscopic left lateral hepatectomy (XML) | Longitudinal Late-Life Health study (XML)
lll ( in XML ) (5)
» largely determined by the filterability of Cr (XML) | ligands are able to selectively extract Am (XML) | ligands with variable conditional stability constants for Fe (XML) | likely to play a major role in Fe (XML) | little with extractant, which implies that most of the Fe (XML)
LLRF ( in XML ) (5)
» low-level RF (XML) | low-level radio frequency (XML)
LLT-ESP ( in XML ) (5)
» low-low temperature electrostatic precipitator (XML) | low-low temperature ESP (XML)
LLPSRGs ( in XML ) (5)
» LLPS-related genes (XML) | liquid-liquid phase separation related genes (XML)
LLTT ( in XML ) (5)
» low level technology tool (XML) | low-level treadmill tests (XML) | Longiflorum x Trumpet hybrid (XML) | low-level laser treatment (XML)
LLM's ( in XML ) (5)
» large language models (XML) | local linear maps (XML)
LLSC ( in XML ) (5)
» lumbar spinal canal (XML) | long-lasting Silastic catheter (XML) | Leukemia & Lymphoma Society of Canada (XML) | lateral lumbar spinal canal (XML) | Living Lab on Sharing and Circular Economy (XML)
LLMP ( in XML ) (5)
» lower limb muscle power (XML) | lower limb movement patterns (XML) | log-linear model with Poisson distribution (XML) | lower limit of melodic pitch (XML)
LLHD ( in XML ) (5)
» lean-led hospital design (XML) | low latency and high data rate (XML) | left lateral hepatic duct (XML)
LLVD ( in XML ) (5)
» lower-limb varicose disease (XML) | lower limb vascular disease (XML) | lower limb venous Duplex (XML) | locoregional lung ventilation distribution (XML)
LLPI ( in XML ) (5)
» long-lasting permethrin impregnated (XML) | long-lasting protection inducer (XML)
LLC's ( in XML ) (5)
» long-lived coherences (XML) | London County Council's (XML)
LLCM ( in XML ) (5)
» lyotropic liquid crystalline mesophases (XML) | light-chain myeloma (XML) | Lewis Lung Carcinoma conditioned media (XML) | Low-Latency, Continuous-Motion (XML)
LLZ ( in XML ) (5)
» Lilizhi (XML) | LL-Z1640-2 (XML) | low-lying zone (XML) | Lower-Longevity Zone (XML) | low-lying mountain zone (XML)
lle ( in XML ) (5)
» long, located between rrnS and tRNA (XML) | L. striatellus was found between srRNA and tRNA (XML) | low levels of estrogen (XML) | lower lens-eye (XML)
LL-DAP-AT ( in XML ) (5)
» LL-diaminopimelate aminotransferase (XML)
LL/BL ( in XML ) (5)
» lepromatous/borderline lepromatous (XML) | leprosy/borderline leprosy (XML)
LLDRH ( in XML ) (5)
» laparoscopic living donor right hemihepatectomy (XML)
LL-TRD ( in XML ) (5)
» late-life treatment-resistant depression (XML) | Late-life depression is often resistant to standard treatment (XML) | late-life TRD (XML)
LLSG ( in XML ) (5)
» left lateral segment grafts (XML) | laser light-scattering granulometer (XML) | lower lumbar stability group (XML) | large litter size group (XML)
LLP-1 ( in XML ) (5)
» lentivirus lytic peptide 1 (XML) | lentivirus lytic peptides segment 1 (XML) | lentiviral lytic peptide type 1 (XML)
LLGs ( in XML ) (5)
» local-level government areas (XML) | left lobe grafts (XML) | legume lost genes (XML) | larger litter size groups (XML) | local liver grafts (XML)
LLQR ( in XML ) (5)
» low-level quinolone resistance (XML)
LLP2 ( in XML ) (5)
» lentiviral lytic peptide 2 (XML)
LLTA ( in XML ) (5)
» long-lasting tonic activation (XML) | laparoscopic-assisted left thoracoabdominal esophagectomy (XML) | laparoscopic liver tumor ablation (XML)
LLPR ( in XML ) (5)
» Limb Loss and Preservation Registry (XML) | large-lesion-poor-recovery (XML) | Lower limb power rehabilitation (XML) | linearized local perturbation response (XML)
LLSCCs ( in XML ) (5)
» lower lip squamous cell carcinomas (XML)
LLDF ( in XML ) (5)
» low-level data fusion (XML) | Longitudinal Log-Demons Framework (XML)
LLEI ( in XML ) (4)
» labor law equity index (XML) | low-level laser energy irradiation (XML) | Legal Epidemiology Study of Associations Between State-Level Labor Laws (XML)
LLF-TB ( in XML ) (4)
» lower lung field tuberculosis (XML)
L. litseifolius ( in XML ) (4)
» Lithocarpus litseifolius (XML) | Lithocarpus litseifolius (Hance) Chun (XML)
lld ( in XML ) (4)
» leaflet development (XML) | lower level discriminators (XML)
LLMO ( in XML ) (4)
» layered lithium-rich manganese oxide-based (XML) | layered Li-rich Mn-based oxides (XML) | lithium-rich manganese-based cathode materials (XML) | I-Low lean mass and Osteoporosis (XML)
LLBW ( in XML ) (4)
» lighter low birth weight (XML) | lung, liver, and body weights (XML) | Lingual, labial and buccal weakness (XML)
LLFDI-CAT ( in XML ) (4)
» Late-Life Function and Disability Instrument Computer Adaptive Test (XML)
LLGL2 ( in XML ) (4)
» lethal giant larvae 2 (XML) | larvae homolog 2 (Drosophila) (XML) | Lethal giant larvae homolog 2 (XML)
LLPAD ( in XML ) (4)
» lower limb peripheral arterial disease (XML)
LLPN ( in XML ) (4)
» laser-assisted LPN (XML) | laser-assisted laparoscopic partial nephrectomy technique (XML)
LLMM ( in XML ) (4)
» lower limb muscle mass (XML) | longitudinal linear mixed model (XML) | lower-leg muscle mass (XML)
LLABCs ( in XML ) (4)
» locally advanced breast cancers (XML)
L. luteola ( in XML ) (4)
» Lymnaea luteola (XML)
L-LMICs ( in XML ) (4)
» low- and lower-middle-income countries (XML) | low-income or lower-middle-income countries (XML)
LLMR ( in XML ) (4)
» low-level mupirocin resistance (XML) | lower limb muscle ratio (XML)
LLC-SD ( in XML ) (4)
» LLC-Symmetric Division (XML) | largely symmetric division for self-renewal (XML) | Lewis lung adenocarcinoma SD (XML)
LLm ( in XML ) (4)
» lumbar lordosis (XML) | lumbar lordosis measured (XML)
LLRD ( in XML ) (4)
» long-lived radioactive dust (XML) | long-latency respiratory disease (XML) | life-limiting rare diseases (XML)
LLDVT ( in XML ) (4)
» lower limb deep vein thrombosis (XML)
LLAMA ( in XML ) (4)
» Lead-Likeness and Molecular Analysis (XML) | Lyman-Alpha Measurement Apparatus (XML)
LLS1 ( in XML ) (4)
» LETHAL LEAF SPOT1 (XML) | LATERAL LEAFLET SUPPRESSION1 (XML) | Lateral Leaflet Suppression 1 (XML) | lethal leaf spot 1 (XML)
LLSimpute ( in XML ) (4)
» local least squares imputation (XML)
LLP3 ( in XML ) (4)
» lentiviral lytic peptide 3 (XML) | lentiviral lytic peptide-3 motif (XML)
LLMCs ( in XML ) (4)
» landfill leachate membrane concentrates (XML) | Liquid-liquid membrane contactors (XML)
LLPO ( in XML ) (4)
» long-lived photooxidants (XML)
LLWS ( in XML ) (4)
» Live Long Walk Strong (XML) | Little League World Series (XML)
LLFDI-FC ( in XML ) (4)
» Late-Life Function and Disability Index: function component (XML) | Late-Life Function and Disability Instrument (XML) | LLFDI-Function Component (XML)
LLIM ( in XML ) (4)
» Limited Literacy Impact Measure (XML) | Luminescence lifetime imaging (XML) | liquid/liquid interface microsensor (XML) | luminescence lifetime imaging microscopy (XML)
LLTQ ( in XML ) (4)
» Lower Limb Task Questionnaire (XML)
LL-EPI ( in XML ) (4)
» Look-Locker echo-planar imaging (XML) | Look-Locker EPI (XML)
LLSV ( in XML ) (4)
» low ligation of spermatic vessels (XML) | leg large subcutaneous vein (XML) | left lateral segment volume (XML)
LLOMe ( in XML ) (4)
» Leu-Leu-OMe (XML) | l-leucyl-l-leucine O-methyl ester (XML)
LLMT ( in XML ) (4)
» lower lid margin thickness (XML)
LLIH ( in XML ) (4)
» long-lasting insecticidal hammocks (XML) | long-lasting insecticide-treated hammock (XML)
l-LPM ( in XML ) (4)
» left lateral plate mesoderm (XML)
LLSE ( in XML ) (4)
» language learning self-efficacy (XML) | linear least square error (XML) | left side-lying sling exercise (XML) | liquid-liquid solvent extraction (XML)
LLNC ( in XML ) (4)
» landfill leachate nanofiltration concentrate (XML)
LLBO ( in XML ) (4)
» Laser Light-Based Opacitometer (XML)
LLUs ( in XML ) (4)
» lower limb ulcers (XML)
LLDT ( in XML ) (4)
» lipid-lowering drug treatment (XML) | lateralized lexical decision task (XML) | lower lid distraction test (XML)
LLBT ( in XML ) (4)
» lasers and light-based therapies (XML) | large-leaf congou black teas (XML) | log-linear Bradley-Terry (XML)
LLSVP ( in XML ) (4)
» large low-shear-velocity province (XML) | large low shearwave-velocity province (XML)
LLFP ( in XML ) (4)
» LLF pneumonia (XML) | Label Fuzzy Proportions (XML) | long-lived fission products (XML) | ligamentum flavum process (XML)
LLMPP ( in XML ) (4)
» leukemia lymphoma molecular profiling project (XML) | Lymphoma/Leukemia Molecular Profiling Project (XML)
LL-IRI ( in XML ) (4)
» lower limb ischemia/reperfusion injury (XML)
LLFE ( in XML ) (4)
» Leucas lavandulaefolia (XML) | lotus leaf flavonoid extract (XML) | Ligustrumlucidum fruit extract (XML)
LLCE ( in XML ) (4)
» liquid-liquid cartridge extraction (XML) | liquid-liquid continuous extraction (XML) | lower limbs cycle ergometer (XML)
LLIFs ( in XML ) (4)
» lateral lumbar interbody fusions (XML) | lateral lumbar intervertebral fusions (XML)
LLHs ( in XML ) (4)
» low-level heuristics (XML) | layered lanthanide hydroxides (XML)
LLPv2 ( in XML ) (4)
» Liverpool Lung Project V.2 (XML) | Liverpool Lung Project version 2 (XML)
L. Lactis ( in XML ) (4)
» lactococcus lactis (XML) | Leuconostoc lactis (XML)
LL-VMB ( in XML ) (3)
» low-Lactobacillus vaginal microbiota (XML)
LLABC ( in XML ) (3)
» locally advanced breast cancer (XML) | LL resin was additionally tested with an air-barrier coating (XML)
LLGP-EITB ( in XML ) (3)
» lentil lectin-bound glycoproteins/enzyme-linked immunoelectrotransfer blot (XML)
lLNvs ( in XML ) (3)
» large lateral ventral neurons (XML) | Large lateral ventral arousal neurons (XML)
LLOAD ( in XML ) (3)
» lower-limb occlusive arterial disease (XML)
LLAMS ( in XML ) (3)
» Lower Limb Extremity Amputee Measurement Scale (XML) | lumen apposing metal stent (XML) | Lower Limb Amputee Measurement Scale (XML)
LLVS ( in XML ) (3)
» low-level vagus nerve stimulation (XML) | low-level vagosympathetic trunk stimulation (XML) | low-luminance visual stimulation (XML)
LLPv3 ( in XML ) (3)
» Liverpool Lung Project version 3 (XML) | Liverpool Lung cancer Project risk model version 3 (XML)
LL-GBP ( in XML ) (3)
» long-limb bypass (XML) | long-limb GBP (XML) | long-limb gastric bypass (XML)
LLMV ( in XML ) (3)
» lower limb muscle volume (XML) | lowest levels of method validation (XML)
LLIL ( in XML ) (3)
» low-level infrared laser (XML) | lateral incisor length (XML)
LLSTs ( in XML ) (3)
» laparoscopic liver surgery techniques (XML) | limitations on life support techniques (XML) | large lateral spreading tumors (XML)
LL-CL ( in XML ) (3)
» low-level chemiluminescence (XML)
L-LDI ( in XML ) (3)
» L-lysine ethyl ester diisocyanate (XML)
LLGC ( in XML ) (3)
» local and global consistency method (XML) | Lymphoepithelioma-like gastric carcinoma (XML) | Longitudinal latent growth curve (XML)
LLCB ( in XML ) (3)
» linear latent causal Bayes (XML) | longest side-length of a circumscribed box (XML)
LL-DAP ( in XML ) (3)
» LL-diaminopimelic acid (XML) | large LL-diaminopimelic acid (XML)
LLLL ( in XML ) (3)
» Low-level laser-assisted liposuction (XML) | late-life language learning (XML) | lateral liver lobectomy (XML)
l-LTP ( in XML ) (3)
» Late long-term potentiation (XML) | late-LTP (XML)
L-LNR ( in XML ) (3)
» low-LNR (XML)
LLCV ( in XML ) (3)
» lilac leaf chlorosis virus (XML)
LLOC ( in XML ) (3)
» lumbar lordosis overcorrection (XML) | lowest level of consciousness (XML) | left occipital condyle (XML)
LLESs ( in XML ) (3)
» low-lying excited states (XML) | low-lying electronic states (XML)
LLREs ( in XML ) (3)
» lower limb rehabilitation exoskeletons (XML) | low-level radioactive effluents (XML)
LLSD ( in XML ) (3)
» lower limb sensory deficits (XML) | Lonar Lake Sediment isolates (XML) | lymphadenoma lacking sebaceous differentiation (XML)
L-LEP ( in XML ) (3)
» Lepromatous leprosy (XML) | limited English proficiency (XML)
LLE ratio ( in XML ) (3)
» lung-to-liver elastography ratio (XML)
LLGPs ( in XML ) (3)
» lentil lectin-purified glycoproteins (XML)
L-loop ( in XML ) (3)
» larger loop (XML) | left-sided morphological right ventricle and right-sided morphological left ventricle (XML) | luminal loop (XML)
LL7 ( in XML ) (3)
» LUX-Lung 7 (XML) | Lactococcus lactis at 107 CFU/g (XML)
LLLM ( in XML ) (3)
» lower limb lean-mass (XML)
LLVP ( in XML ) (3)
» left lateral ventricular preexcitation (XML) | large low-velocity province (XML) | lower limb vascular pain (XML)
L-line ( in XML ) (3)
» line selected against backfat thickness (XML) | low female reproductive investment (XML) | lethal-line (XML)
LLIVCT ( in XML ) (3)
» ligand-to-ligand intervalence charge transfer (XML)
L-LV ( in XML ) (3)
» lateral left ventricle (XML) | L-leucovorin (XML)
LLBS ( in XML ) (3)
» lower limb bypass surgery (XML) | LLBS shoes than in the HLBS shoes (XML) | low-LBS (XML)
LLNWP ( in XML ) (3)
» Lotus Lake National Wetland Park (XML) | low-latitude northwestern Pacific (XML)
LLMZ ( in XML ) (3)
» leg lean mass z-score (XML)
LL-PI ( in XML ) (3)
» lumbar lordosis-pelvic incidence (XML) | LL-pelvic incidence (XML)
LLRY ( in XML ) (3)
» long-limb Roux-en-Y (XML) | long loop Roux-en-Y gastrojejunostomy (XML)
LLAP ( in XML ) (3)
» Legionella-like amoebal pathogen (XML) | lower limb adjusted perimeter (XML)
LLNS ( in XML ) (3)
» Landau-Lifshitz-Navier-Stokes (XML) | low-level neurological state (XML)
LLaMA2 ( in XML ) (3)
» Large Language Model Meta AI-2 (XML) | LLM Meta AI 2 (XML) | Language Models by Meta AI 2 (XML)
LLCCs ( in XML ) (3)
» Long linear carbon chains (XML) | Lewis lung carcinoma cells (XML) | long LCCs (XML)
LLIEP ( in XML ) (3)
» low-lying-implantation ectopic pregnancy (XML)
LLPU ( in XML ) (3)
» lower-limb prosthesis user (XML) | liquefied lignin-based polyurethane (XML)
L-LLS ( in XML ) (3)
» laparoscopic LLS (XML) | left lateral sectionectomy (XML)
LLDME ( in XML ) (3)
» Locally Linear Diffeomorphic Metric Embedding (XML)
LLUS ( in XML ) (3)
» late leakage of undetermined source (XML)
LLDB ( in XML ) (3)
» Large linked databases (XML) | Learning-based Local Difference Binary (XML)
LLD-KQ ( in XML ) (3)
» Later Life Depression Knowledge Questionnaire (XML)
LLBD ( in XML ) (3)
» late-life bipolar disorder (XML) | Live Life Better Derbyshire (XML)
LLTTF ( in XML ) (3)
» Living Life to the Full (XML) | Life to the Full (XML)
LLDR ( in XML ) (3)
» leg-length discrepancy ratio (XML) | long-lasting depression of reflexes (XML)
LLv ( in XML ) (3)
» lemnisci lateralis, pars ventralis (XML) | lateral lemniscus, pars ventralis (XML)
LLTO/C ( in XML ) (3)
» lithium lanthanum titanate/carbon (XML) | lithium lanthanum titanium oxide/carbon (XML)
LLACs ( in XML ) (3)
» lupus-like anticoagulants (XML) | lower leg arterial calcifications (XML)
LLUCH ( in XML ) (3)
» Loma Linda University Children's Hospital (XML)
LL-KF140 ( in XML ) (3)
» Lactococcus lactis KF140 (XML)
LLRS-AIM ( in XML ) (3)
» Limb Lengthening and Reconstruction Society AIM (XML) | GOAL-LD scores with a measure of limb deformity complexity (XML)
LLLE ( in XML ) (3)
» lower limb lymphedema (XML) | lower-limb lymphatic edema (XML) | Liquid-liquid-liquid equilibria (XML)
LLoD ( in XML ) (3)
» low limit of detection (XML) | leaf longitudinal diameter (XML)
LLYHZ ( in XML ) (3)
» Longliangyou Huazhan (XML) | Long-Liang-You-Hua-Zhan (XML)
LLSL ( in XML ) (3)
» low-level sick leave (XML) | long-lived small lymphocytes (XML)
LLSME ( in XML ) (3)
» liquid-liquid-solid microextraction (XML)
LLE/AD ( in XML ) (3)
» limited life expectancy and/or advanced dementia (XML) | LLE and/or advanced dementia (XML)
LLPi ( in XML ) (3)
» Liverpool Lung Project Risk Prediction Model for Lung Cancer Incidence (XML) | LLP Incidence Risk Model (XML) | Liverpool lung project incidence risk model (XML)
LLFD ( in XML ) (3)
» long-term LFD (XML) | Late-Life Function and Disability (XML) | life-limiting fetal diagnosis (XML)
LLVL ( in XML ) (3)
» low-level viral load (XML) | Low-level visible light (XML)
LLOI ( in XML ) (3)
» lower leg overuse injury (XML) | Lower limit of identification (XML)
LLPSs ( in XML ) (3)
» liquid-liquid phase separations (XML)
L-LAC ( in XML ) (3)
» l-lactate (XML)
LLGL ( in XML ) (3)
» liquid light-guide lens (XML) | Llglh gene (XML)
LLEBV ( in XML ) (3)
» Lleida bat lyssavirus (XML) | lyssavirus, Lleida bat lyssavirus (XML)
L. LPMC ( in XML ) (3)
» left lateral premotor cortex (XML)
LLC cells ( in XML ) (3)
» Lewis lung cancer cells (XML) | Lewis lung carcinoma cells (XML)
LLFT ( in XML ) (3)
» lower-limb fatigue (XML) | lateral ligament flavum thickness (XML) | locally leptokurtic and fat-tailed (XML)
L-LDHs ( in XML ) (3)
» l-lactate dehydrogenases (XML)
LLPD ( in XML ) (3)
» late luteal phase dysphoric disorder (XML) | late-life psychotic depression (XML)
LLBP ( in XML ) (3)
» local line binary pattern (XML) | LBP divided into groups reporting low (XML)
LLHS ( in XML ) (3)
» leaf litter-derived humic substance (XML) | low light-human segmentation (XML)
LLPV ( in XML ) (3)
» left lower pulmonary vein (XML)
LLf ( in XML ) (3)
» low-dose Lf (XML) | low-dose Lf treatment group (XML)
L-LTD ( in XML ) (3)
» late-LTD (XML) | late-phase long-term synaptic depression (XML) | Late-phase long-term depression (XML)
LL-EP ( in XML ) (3)
» lips relative to the esthetic plane (XML) | lower lip to E-plane (XML) | lower lip protrusion (XML)
LLGL1 ( in XML ) (3)
» LLGL scribble cell polarity complex component 1 (XML) | Lgl, Lgl1 (XML) | lethal giant larvae homolog 1 (XML)
LLBFRT ( in XML ) (3)
» Low-load blood flow restriction training (XML)
LLVEF ( in XML ) (3)
» low left ventricular ejection fraction (XML)
LLAPTR ( in XML ) (3)
» Long-lasting allergic patch test reactions (XML)
LLSelf ( in XML ) (3)
» Lake Louise AMS Self-report Score (XML)
LLHM ( in XML ) (3)
» Laparoscopic limited Heller myotomy (XML) | Lewis lung high metastatic (XML) | Local Linear Histogram Matching (XML)
LLVs ( in XML ) (3)
» light levels variations (XML) | lymphoid leukosis viruses (XML) | lower limit values (XML)
LLECs ( in XML ) (3)
» leptomeningeal lymphatic endothelial cells (XML) | long-lived effector cells (XML)
LLNL's ( in XML ) (3)
» Lawrence Livermore National Laboratory's (XML)
LLRT-BFR ( in XML ) (3)
» low-load resistance training with blood flow restriction (XML)
LLFPs ( in XML ) (3)
» long-lived fission products (XML)
LLC NPs ( in XML ) (3)
» lyotropic liquid crystal nanoparticle (XML) | LLC nanoparticles (XML)
LLC-CM ( in XML ) (2)
» LLC-LN7-conditioned medium (XML)
LLML ( in XML ) (2)
» long lasting microbial larvicides (XML)
LL37 ( in XML ) (2)
» LL37-conjugated gold nanoparticles, LL37-Au NPs (XML) | cathelicidin-LL37 (XML)
LL-SEP ( in XML ) (2)
» long latency somatosensory evoked potentials (XML)
L-LMS ( in XML ) (2)
» lipoleiomyosarcoma (XML)
LLSPs ( in XML ) (2)
» leaderless secretory proteins (XML) | lattice-tuned localized surface plasmons (XML)
LL-HN ( in XML ) (2)
» low-light and high-nitrogen (XML)
LLSW ( in XML ) (2)
» longitudinal leaky surface waves (XML)
LLSAs ( in XML ) (2)
» lateral lenticulostriate arteries (XML)
L. longipalpis ( in XML ) (2)
» Lutzomyia longipalpis (XML)
LLBF ( in XML ) (2)
» left leg blood flow (XML) | Layered Lightweight Blockchain Framework (XML)
LLRER ( in XML ) (2)
» lower-limb rehabilitation exoskeleton robot (XML)
llf ( in XML ) (2)
» lateral funiculi (XML) | large leaf (XML)
LLFQ ( in XML ) (2)
» Lower Limb Function Questionnaire (XML)
LLC-GEN ( in XML ) (2)
» lyotropic liquid crystal genistein-based formulation (XML)
LLSLHFY14 ( in XML ) (2)
» Lactococcus lactis subsp. lactis HFY14 (XML)
LLCNR ( in XML ) (2)
» lesion-to-liver contrast-to-noise ratio (XML)
LLBI ( in XML ) (2)
» lower limb burn injury (XML)
LLHFs ( in XML ) (2)
» lower level health facilities (XML)
LLPJ ( in XML ) (2)
» laparoscopic longitudinal pancreatojejunostomy (XML)
L,L-EC ( in XML ) (2)
» L,L-ethylene dicysteine (XML)
L-LS ( in XML ) (2)
» LyP-1-conjugated liposomes (XML) | low-dose laser treatment group (XML)
LLF TB ( in XML ) (2)
» Lower lung field TB (XML) | Lower lung field tuberculosis (XML)
LLMDs ( in XML ) (2)
» Late-life mood disorders (XML)
LLVSs ( in XML ) (2)
» long-lasting voltage shifts (XML) | lower lobar vessels of the spleen (XML)
L. longirostris ( in XML ) (2)
» Leiocassis longirostris (XML)
l-LTM ( in XML ) (2)
» late long-term memory (XML) | late long-term (XML)
LLLRW ( in XML ) (2)
» low-level liquid radioactive waste (XML)
LLCMs ( in XML ) (2)
» Luminescent liquid crystal materials (XML) | lyotropic liquid crystalline mesophases (XML)
LLDLT ( in XML ) (2)
» low-level diode laser therapy (XML) | liver living donor liver transplantation (XML)
LL-MACE ( in XML ) (2)
» low-load metal-assisted catalytic etching (XML) | low-load MACE (XML)
LLFA ( in XML ) (2)
» lower limb function asymmetry (XML) | Lesion-Focused Attention Loss (XML)
LLBWP ( in XML ) (2)
» LLBWP compared to HLBWP (XML) | low LBWP (XML)
LLC-GFP ( in XML ) (2)
» Lewis-lung carcinoma cells labeled with GFP (XML) | lung carcinoma cells constitutively expressing GFP (XML)
Llgl2 ( in XML ) (2)
» lethal giant larvae 2 (XML) | LLGL Scribble cell polarity complex component 2 (XML)
LLUNA ( in XML ) (2)
» Literate Language Use in Narrative Assessment (XML)
L-L-L ( in XML ) (2)
» low walkability/transit/recreation (XML)
LLL Biostimulation ( in XML ) (2)
» low level laser therapy biostimulation (XML)
LLVNS ( in XML ) (2)
» level left vagus nerve stimulation (XML) | low-level vagosympathetic nerve stimulation (XML)
lls ( in XML ) (2)
» listeriolysin S (XML)
LLLND ( in XML ) (2)
» laparoscopic lateral lymph node dissection (XML) | lateral lymph node dissection for rectal cancer group (XML)
LLFV ( in XML ) (2)
» lunate-lunate facet variance (XML) | Local low-frequency vibration (XML)
LLCL ( in XML ) (2)
» lowland crop-livestock (XML) | Lesion-Level Contrastive Learning (XML)
LLDPEs ( in XML ) (2)
» linear low-density polyethylenes (XML) | linear low-density PEs (XML)
LLRNN ( in XML ) (2)
» low-delay lightweight recurrent neural network (XML)
LLAMSS ( in XML ) (2)
» Lake Louise AMS score (XML) | Lake Louise Acute Mountain Sickness Score (XML)
LLVT ( in XML ) (2)
» lower limb venous thrombosis (XML)
LLSAW ( in XML ) (2)
» longitudinal leaky surface acoustic wave (XML) | longitudinal leaky SAW (XML)
LLIG ( in XML ) (2)
» low-level intervention group (XML) | lower lumbar instability group (XML)
l-lat ( in XML ) (2)
» left-lateral position (XML)
LLUA ( in XML ) (2)
» lumbar lordosis (XML)
LLNle ( in XML ) (2)
» Benzyloxicarbonyl-Leu-Leu-Nle-CHO (XML) | leucine-leucin-norleucinal (XML)
LLSSE ( in XML ) (2)
» Life Study of Social Exchanges (XML)
LLVB ( in XML ) (2)
» low lung volume breathing (XML) | large left ventricular branch (XML)
LLPHF ( in XML ) (2)
» low-level private health facilities (XML)
LLRRs ( in XML ) (2)
» Lower limb rehabilitation robots (XML) | long latency reflex responses (XML)
LLCBF ( in XML ) (2)
» lower limit of CBF autoregulation (XML) | lower limit of cerebral blood flow autoregulation (XML)
LLAO ( in XML ) (2)
» lower limb arterial occlusions (XML) | lysosome-like acidic organelles (XML)
LLHH ( in XML ) (2)
» LLH from the head side approach (XML) | light-light-heavy-heavy (XML)
LLAGN ( in XML ) (2)
» low-luminosity active galactic nucleus (XML)
LLFFM ( in XML ) (2)
» lower limb fat-free (XML) | lower-limb FFM (XML)
L-LLND ( in XML ) (2)
» laparoscopic LLND (XML)
L line ( in XML ) (2)
» low humoral immune reactivity (XML) | low line (XML)
LL-BCVA ( in XML ) (2)
» low-luminance BCVA (XML)
LLTSA ( in XML ) (2)
» linear local tangent space alignment (XML)
LLRDEGs ( in XML ) (2)
» liquidliquid phase separation related differentially expressed genes (XML)
LLD-S ( in XML ) (2)
» LLD patients with suicidal ideation (XML)
LlPDS ( in XML ) (2)
» L. leichtlinii phytoene desaturase (XML)
LLhP ( in XML ) (2)
» LacI DNA-binding domain/linker and the PurR regulatory domain (XML) | LacI/GalR homologues, we have created a chimeric protein (XML)
LLD3 ( in XML ) (2)
» ligation D3 lymph node dissection (XML) | low ligation of the IMA with D3 dissection (XML)
LLoC ( in XML ) (2)
» liver-lobule-chip (XML)
LLHV ( in XML ) (2)
» low-load high-velocity (XML)
LLAN ( in XML ) (2)
» late left anterior negativity (XML)
LLSAWs ( in XML ) (2)
» longitudinal leaky SAWs (XML)
l,l-TMAP ( in XML ) (2)
» N,N,N-trimethyl-l-alanyl-l-proline betaine (XML)
LLCN ( in XML ) (2)
» lncRNAlncRNA co-expression network (XML) | lyotropic liquid crystalline nanosystems (XML)
LLD-MCI ( in XML ) (2)
» LLD and MCI (XML) | LLD with mild cognitive impairment (XML)
LL-BFRE ( in XML ) (2)
» low-load blood-flow-restriction exercise (XML)
LLET ( in XML ) (2)
» ligand-to-ligand ET (XML) | low linear energy transfer (XML)
LL-RET ( in XML ) (2)
» low-load resistance exercise training (XML)
L-LCR ( in XML ) (2)
» L-lactate ferricytochrome c oxidoreductase (XML)
LLK48 ( in XML ) (2)
» Lactococcus lactis KUST48 (XML) | L. lactis KUST48 (XML)
LLPHFs ( in XML ) (2)
» low-level private health facilities (XML)
LLMIs ( in XML ) (2)
» lower limit of measuring intervals (XML) | lower limb muscle injuries (XML)
L,L-DAP ( in XML ) (2)
» L,L-diaminopimelic acid (XML) | L,L-diaminopimelate (XML)
LL-OEW ( in XML ) (2)
» light line OEW (XML) | Light Line Optoelectrowetting (XML)
LL2-Luc2 ( in XML ) (2)
» Lung 2-luciferase 2 cells (XML)
LLPS-PIESA ( in XML ) (2)
» liquid-liquid phase-separation-driven polymerization-induced electrostatic self-assembly (XML)
LLCGs ( in XML ) (2)
» lower lateral cartilaginous grafts (XML) | lower-limb compression garments (XML)
l-LSM ( in XML ) (2)
» l-lysine semi-maleate (XML)
LLLC ( in XML ) (2)
» Low level leucocyte counting (XML) | low luminance low contrast (XML)
Lls1 ( in XML ) (2)
» lethal leaf spot 1 (XML)
L. lactis subsp. lactis ( in XML ) (2)
» Lactococcus lactis subsp. lactis (XML)
LLPE ( in XML ) (2)
» lifelong PE (XML) | left-sided LPE (XML)
LLROM ( in XML ) (2)
» Lower limb range of motion (XML)
lLOC ( in XML ) (2)
» left lateral occipital cortex (XML)
LLSB ( in XML ) (2)
» locking-loop suture bridge (XML) | long-lasting slow bursting (XML)
LLMOs ( in XML ) (2)
» layered lithium transition metal oxides (XML) | Layered, Li-rich Mn-based oxides (XML)
l loop ( in XML ) (2)
» left-hand topology (XML)
LLGCV ( in XML ) (2)
» L-Val-L-Val-GCV (XML)
LLVC ( in XML ) (2)
» lateral lingual vascular canal (XML) | lymphatic limbal vascular complex (XML)
LL-FAS ( in XML ) (2)
» Lower Limb-Function Assessment Scale (XML)
l,l-DAP ( in XML ) (2)
» l,l-diaminopimelate (XML) | l,l-diaminopimelic acid (XML)
l,l-SDAP ( in XML ) (2)
» N-succinyl-l,l-diaminopimelic acid (XML)
LLAA ( in XML ) (2)
» Low-liquid aqueous ammonia (XML) | LAA ligation (XML)
llb ( in XML ) (2)
» lullaby (XML) | lethal left of bithorax gene (XML)
LLLT.G ( in XML ) (2)
» LLLT group (XML)
L-Lys-HCl ( in XML ) (2)
» l-lysine monohydrochloride (XML) | L-lysine-HCl (XML)
L-LBM ( in XML ) (2)
» limb lean body mass (XML)
lls1 ( in XML ) (2)
» long life span 1 (XML) | lethal leaf spot1 (XML)
LLDAV ( in XML ) (2)
» Lamuim leaf distortion-associated virus (XML)
LLC-Luc ( in XML ) (2)
» LLC-luciferase (XML) | Lewis lung carcinoma luciferase (XML)
LLDK ( in XML ) (2)
» LLDK group (XML) | lower lumbar degenerative kyphosis (XML)
LLNet ( in XML ) (2)
» localization network (XML) | Learning Network with a Relation Aware Transformer (XML)
LLD-SI ( in XML ) (2)
» LLD and SI (XML) | LLD with SI (XML)
LLi ( in XML ) (2)
» Lake Lichenskie (XML) | lateral lemniscus, pars intermedia (XML)
LLVVs ( in XML ) (2)
» lower limb varicose veins (XML)
LLATSA ( in XML ) (2)
» left anterior transperitoneal submesocolic adrenalectomy (XML)
L-LYC ( in XML ) (2)
» lycopene liposomes (XML) | lycopene-loaded liposomes (XML)
LLQC ( in XML ) (2)
» lower limit of quantification (XML)
LLUC ( in XML ) (2)
» lumbar lordosis undercorrection (XML) | learning and update control module (XML)
LLT-ESPs ( in XML ) (2)
» low-low-temperature ESPs (XML) | low-low temperature electrostatic precipitators (XML)
LLRa ( in XML ) (2)
» LLR amplitude (XML) | long-latency response amplitude (XML)
LLNB ( in XML ) (2)
» low level narrow band (XML) | laparoscopic lymph node biopsy (XML)
LLSPD-Net ( in XML ) (2)
» Low-Light Sparse Polarization Demosaicing Network (XML)
LLAMAS ( in XML ) (2)
» low-latency adaptive optical mirror system (XML) | lickety-split ligand-affinity-based molecular angling system (XML)
LLFI-10 ( in XML ) (2)
» Lower Limb Functional Index-10 (XML)
LLS 2 and 3 ( in XML ) (2)
» laparoscopic liver sectionectomy 2 and 3 (XML)
LLtime ( in XML ) (2)
» lower lethal time (XML)
LLac ( in XML ) (2)
» Leuconostoc lactis (XML) | low light-acclimated (XML)
LLNI ( in XML ) (2)
» low-level neuroinflammation (XML)
LLPF ( in XML ) (2)
» longissimus lumborum peak force (XML) | lateral leg perforator flap (XML)
LL-14 ( in XML ) (2)
» 14-residue-long lysine-rich cationic antimicrobial peptide (XML) | LKWLKKLLKWLKKL (XML)
LLVY ( in XML ) (2)
» Suc-Leu-Leu-Val-Tyr-AMC (XML) | N-succinyl-Leu-Leu-Val-Tyr 7-amino-4-methylcoumarin (XML)
Llo PRP ( in XML ) (2)
» low-leukocyte PRP (XML) | leukocyte-low platelet rich plasma (XML)
LLGHGs ( in XML ) (2)
» long-lived greenhouse gases (XML)
LL-CNN ( in XML ) (2)
» lifelong learning-based convolutional neural network (XML) | life-long learning segmentation CNN (XML)
LLETZ-cone ( in XML ) (2)
» large loop excision of transformation zone, as a cone procedure (XML) | Large Loop Excision of the Transformation Zone (XML)
LLNMs ( in XML ) (2)
» lateral lymph node metastases (XML) | Low-solubility, low-permeability natural medicines (XML)
LLP-I ( in XML ) (2)
» lentiviral lytic polypeptide I (XML)
LLPSRS ( in XML ) (2)
» LLPS-related risk score (XML) | LLPS-related signature (XML)
llmRNA ( in XML ) (2)
» leaderless mRNA (XML)
LLOT ( in XML ) (2)
» full-length LLO toxoid (XML) | Laplacian Linear Optimal Transport (XML)
L-Leu-L-Pro ( in XML ) (2)
» levels found in dough prior to baking. cis-Cyclo (XML) | liquid chromatography (HPLC) was performed to explore cyclo (XML)
LLTIs ( in XML ) (2)
» life- and limb-threatening injuries (XML)
LLC-MDR1 ( in XML ) (2)
» Laboratories Cell Porcine Kidney 1 cells overexpressing MDR1 (XML) | LLC-PK1, and its transformant cells expressing human P-glycoprotein (XML)
LLDKT ( in XML ) (2)
» living donor kidney transplantation (XML)
LLP1 ( in XML ) (2)
» LECTIN-LIKE PROTEIN1 (XML)
LLBE ( in XML ) (2)
» linearized lattice Boltzmann equation (XML) | Landfill leachate bio-treated effluent (XML)
LLMF ( in XML ) (2)
» lower limb motor function (XML) | lensless matched filter (XML)
LLCW ( in XML ) (2)
» Life Lounge Clinical Workflow (XML) | Los Laureles Canyon watershed (XML)
L-LDA ( in XML ) (2)
» labeled latent Dirichlet allocation (XML)
LLIHNs ( in XML ) (2)
» long-lasting insecticidal hammock nets (XML)
LLGI ( in XML ) (2)
» log-likelihood gain on intensity (XML) | low level gamma irradiation (XML)
LLACS ( in XML ) (2)
» lower limb arterial calcification score (XML)
LLIRCT ( in XML ) (2)
» liquid-liquid interface recrystallization technique (XML)
LLPB ( in XML ) (2)
» low-leukocyte and -platelet blood (XML) | low-lying peroneus brevis (XML)
LLCRs ( in XML ) (2)
» lesion-to-liver contrast ratios (XML) | leadership line care rounds (XML)
llz ( in XML ) (2)
» lounge lizard (XML)
LL-RT ( in XML ) (2)
» low-load resistance exercise (XML) | LL-BFR-RT (XML)
LLE-BFR ( in XML ) (2)
» low-load resistance exercise with blood flow restriction (XML)
llmJOA ( in XML ) (2)
» lower limb mJOA (XML)
LL35 ( in XML ) (2)
» lead length at 35 days (XML) | Leech lectin 35 (XML)
LLAPC ( in XML ) (2)
» log-linear age-period-cohort (XML)
LL-TFE ( in XML ) (2)
» Look-Locker turbo-field-echo (XML)
LLLTs ( in XML ) (2)
» low-level laser therapies (XML)
LL-Gp ( in XML ) (2)
» lentil-lectin semi-purified glycoprotein extract of T. solium (XML) | lentil-lectin purified glycoprotein (XML)
L-LUS ( in XML ) (2)
» Laparoscopy with laparoscopic ultrasound (XML)
LLnV ( in XML ) (2)
» N-carbobenzoxy-L-leucyl-L-leucyl-L-norvalinal (XML)
Lla-Met ( in XML ) (2)
» linolenic acid-metronidazole (XML) | compound-linolenic acid-metronidazole (XML)
LL-CDs ( in XML ) (2)
» L-cystine were selected as precursors for carbon dots (XML) | ligustrum lucidum carbon dots (XML)
LL-MN ( in XML ) (2)
» lupus-like membranous nephropathy (XML) | lumber longissimus muscle (XML)
LLON ( in XML ) (2)
» Leprous late-onset neuropathy (XML)
LL-37_LDL ( in XML ) (2)
» LL-37 complexed with LDL (XML)
LLDL ( in XML ) (2)
» low-level diode laser (XML)
LLSRS ( in XML ) (2)
» Lake Louise self-report score (XML)
Llo ( in XML ) (2)
» Legionella longbeachae (XML) | L. longbeachae, endogenous SidC (XML)
lli ( in XML ) (2)
» leafless inflorescence (XML)
LLEE ( in XML ) (2)
» lotus leaf ethanol extract (XML) | low-level exercise echocardiography (XML)
LLL-STS ( in XML ) (2)
» lower limb loading during the sit-to-stand (XML)
LLsME ( in XML ) (2)
» liquid-liquid semimicroextraction (XML)
LL-S ( in XML ) (2)
» LL virus of gs antigen into eggs (XML) | low-burden stable group (XML)
LLAB ( in XML ) (2)
» Lower limb arterial blockage (XML) | Legionella-like Arcella-associated bacteria (XML)
LLTRD ( in XML ) (2)
» late-life treatment resistant depression (XML)
L. lactis NCDO 2118 ( in XML ) (2)
» Lactococcus lactis NCDO 2118 (XML)
l-LNv ( in XML ) (2)
» large ventrolateral neurons (XML)
LL-HL ( in XML ) (2)
» low-light-to-high-light (XML) | LL plants were transferred to a high-sunlight environment (XML)
L-LAK ( in XML ) (2)
» keratomileusis-LAK (XML) | linked laser asymmetric keratectomy (XML)
LLT50 ( in XML ) (2)
» lethal temperatures at 50% mortality (XML) | lethal temperature to kill 50% of the population (XML)
L-LecRKs ( in XML ) (2)
» L-type LecRKs (XML) | lectin receptor-like kinases (XML)
LLD-CBT ( in XML ) (2)
» LLD-specific cognitive behavioral therapy (XML)
L-LSGP ( in XML ) (2)
» large sialoglycoprotein of human lymphocytes (XML)
L-LDL ( in XML ) (2)
» large low-density lipoprotein (XML) | low LDL-C (XML)
LLTV ( in XML ) (2)
» Lipoblastoma-like tumor of the vulva (XML) | loose-leaf tobacco vaporizer (XML)
LLMG ( in XML ) (2)
» lower-lip mucosal graft (XML) | Lieb-Liniger-McGuire (XML)
LLD-ACV ( in XML ) (2)
» delta-L-alpha-aminoadipyl-L-cysteinyl-D-valine (XML)
LLOQ QC ( in XML ) (2)
» limit of quantification of quality control (XML)
LLC-NPs ( in XML ) (2)
» low lipid core-nanoparticles (XML) | lyotropic liquid crystal nanoparticles (XML)
LLDNs ( in XML ) (2)
» lower-limb drainage nodes (XML) | laparoscopic living-donor nephrectomies (XML)
LLHF ( in XML ) (2)
» lower level health facilities (XML) | lowest lean/highest fat (XML)
LLE/LTP ( in XML ) (2)
» liquid-liquid extraction with low temperature partition (XML)
LLC CM ( in XML ) (2)
» Lewis lung carcinoma conditioned medium (XML) | lung cancer cells-derived conditioned medium (XML)
LLID ( in XML ) (2)
» LocusLink ID (XML)
LLTG ( in XML ) (2)
» low load training group (XML) | Lipid-lowering therapy Group (XML)
LLFTB ( in XML ) (2)
» lower-lung-field TB (XML)
LLBB ( in XML ) (2)
» long-limb surgical biliary bypass (XML) | lowland blanket bog (XML)
LLLvel ( in XML ) (2)
» LLL velocity (XML) | lower leg length velocity (XML)
L. lactis NZ9000 ( in XML ) (2)
» Lactococcus lactis NZ9000 (XML)
LLUSD ( in XML ) (2)
» Loma Linda University School of Dentistry (XML)
LL/HD ( in XML ) (2)
» low LV and high disability (XML) | lesion load/high disability group (XML)
LLLal ( in XML ) (2)
» Leu-Leu-Leu-aldehyde (XML) | Leu-Leu-Leu-al (XML)
L-LAMP ( in XML ) (2)
» lyophilized loop mediated isothermal amplification (XML)
LLMUPR ( in XML ) (2)
» low-level mupirocin-resistant (XML)
l-LAC ( in XML ) (2)
» l-lactate concentrations (XML)
LLMA ( in XML ) (2)
» lower limb mechanical axis (XML)
L-lysine-HCl ( in XML ) (2)
» levels mentioned could be achieved by lysine supplements (XML) | L-lysine hydrochloride (XML)
LLHC ( in XML ) (2)
» lower-level healthcare (XML) | low luminance high contrast (XML)
LLJs ( in XML ) (2)
» low-level jets (XML)
LLR-Ro ( in XML ) (2)
» lower limb rehabilitation robot (XML)
lld-ACV ( in XML ) (2)
» delta-l-alpha-aminoadipoyl-l-cysteinyl-d-valine (XML)
LLMPs ( in XML ) (2)
» local labour market programmes (XML) | late-life mortality plateaus (XML)
LLys ( in XML ) (2)
» lipoyllysine (XML)
LLEP ( in XML ) (2)
» long-latency evoked potentials (XML) | lower limb extensor power (XML)
LLD-NS ( in XML ) (2)
» LLD patients without suicidal ideation (XML)