Abbreviation List in Life Science - LL
The following abbreviations beginning with 'LL' are found in the Allie database (>=2, order of frequency). Search for one's corresponding long forms on Allie by clicking it.
LL ( in XML ) (4644)
» lumbar lordosis (XML) | longissimus lumborum (XML) | lepromatous leprosy (XML) | lower limb (XML) | low light (XML) ...
LLLT ( in XML ) (2214)
» low-level laser therapy (XML) | low-level laser treatment (XML) | low-level laser/light therapy (XML) | low reactive-level laser therapy (XML) | low-level lasers therapy (XML) ...
LLOQ ( in XML ) (1695)
» lower limit of quantification (XML) | lower LOQ (XML) | limit of lower quantification (XML) | linearity, limit of quantification (XML) | Lower Limit of Quantity (XML) ...
LLC ( in XML ) (1688)
» Lewis lung carcinoma (XML) | Lewis lung cancer (XML) | lyotropic liquid crystal (XML) | lower lateral cartilage (XML) | Lake Louise criteria (XML) ...
LLD ( in XML ) (1575)
» leg length discrepancy (XML) | late-life depression (XML) | lower limit of detection (XML) | lipid-lowering drugs (XML) | left lateral decubitus (XML) ...
LLPS ( in XML ) (1394)
» liquid-liquid phase separation (XML) | low-load prolonged stretch (XML) | lower-limb paralysis simulator (XML) | low-dose LPS (XML) | LLPS-DRs (XML) ...
LLE ( in XML ) (1361)
» liquid-liquid extraction (XML) | locally linear embedding (XML) | largest Lyapunov exponent (XML) | liquid-liquid equilibrium (XML) | loss of life expectancy (XML) ...
LLMs ( in XML ) (1134)
» large language models (XML) | lipid-laden macrophages (XML) | lipid-lowering medications (XML) | language models (XML) | language learning models (XML) ...
LLR ( in XML ) (984)
» laparoscopic liver resection (XML) | log-likelihood ratio (XML) | long latency response (XML) | long-latency reflex (XML) | locally low-rank (XML) ...
LLINs ( in XML ) (822)
» long-lasting insecticidal nets (XML) | long-lasting impregnated nets (XML) | long-lasting insecticidal mosquito nets (XML) | long-lasting treated mosquito nets (XML) | interventions-long-lasting insecticidal nets (XML) ...
LLL ( in XML ) (799)
» late lumen loss (XML) | left lower lobe (XML) | low-level laser (XML) | lower limb lymphedema (XML) | lower leg length (XML) ...
LLS ( in XML ) (781)
» laser light scattering (XML) | Lake Louise Score (XML) | left lateral sectionectomy (XML) | left lateral segment (XML) | linear least squares (XML) ...
LLT ( in XML ) (718)
» lipid-lowering therapy (XML) | lipid layer thickness (XML) | lipid-lowering treatment (XML) | liquid-liquid transition (XML) | lower lethal temperature (XML) ...
LLO ( in XML ) (585)
» listeriolysin O (XML) | lipid-linked oligosaccharide (XML) | laser lift-off (XML) | Li-rich layered oxide (XML) | lithium-rich layered oxide (XML) ...
LLA ( in XML ) (536)
» lower limb amputation (XML) | lumbar lordosis angle (XML) | lower limit of autoregulation (XML) | lipid-lowering agents (XML) | lumbar lordotic angle (XML) ...
LLM ( in XML ) (502)
» large language model (XML) | lipid-lowering medication (XML) | leg lean mass (XML) | lipid-laden macrophages (XML) | Logic Learning Machine (XML) ...
LLN ( in XML ) (495)
» lower limit of normal (XML) | lateral lymph node (XML) | limit of normal (XML) | lingual lymph node (XML) | language, literacy, and numeracy (XML) ...
LLIF ( in XML ) (474)
» lateral lumbar interbody fusion (XML) | lumbar lateral interbody fusion (XML) | lateral lumbar transpsoas interbody fusion (XML) | lateral lumbar intervertebral fusion (XML) | Lateral lumbar and thoracic interbody fusion (XML) ...
LLNA ( in XML ) (449)
» local lymph node assay (XML) | local lymph node assay using 5-bromo-2-deoxyuridine (BrdU) with flow cytometry (XML) | local lymph node assay: 5-bromo-2-deoxyuridine-flow cytometry method (XML) | local lymph node (XML) | lymph node assay: bromodeoxyuridine-enzyme-linked immunosorbent assay (XML) ...
LLETZ ( in XML ) (297)
» large loop excision of the transformation zone (XML) | loop excision of the cervical transformation zone (XML) | loop electric excision for the transformation zone (XML) | limited-excision resulted in a substantially lower cone size (XML) | large loop excision of the TZ (XML) ...
LLP ( in XML ) (292)
» long-lasting potentiation (XML) | lower limb prosthesis (XML) | lateral locking plate (XML) | Liverpool Lung Project (XML) | left lateral position (XML) ...
LLV ( in XML ) (250)
» low-level viremia (XML) | lymphoid leukosis virus (XML) | lean leg volume (XML) | lion lentivirus (XML) | lower limit of vulnerability (XML) ...
LLIN ( in XML ) (240)
» long-lasting insecticidal net (XML) | long-lasting impregnated nets (XML) | Long lasting impregnated mosquito net (XML) | long-lasting factory-treated insecticidal net (XML) | successful.Long-lasting insecticidal nets (XML) ...
LLI ( in XML ) (206)
» leg length inequality (XML) | limiting longstanding illness (XML) | language-learning impairment (XML) | liquid-liquid interface (XML) | life-limiting illness (XML) ...
LLDPE ( in XML ) (182)
» linear low-density polyethylene (XML) | low-density polyethylene (XML) | linear low-density PE (XML) | Low-Linear Density Polyethylene (XML)
LLCs ( in XML ) (174)
» lyotropic liquid crystals (XML) | life-limiting conditions (XML) | large luteal cells (XML) | lamellar liquid crystals (XML) | Lewis lung carcinoma cells (XML) ...
LLOD ( in XML ) (150)
» lower limit of detection (XML) | late-late onset disease (XML) | lower detection limit (XML) | late-life onset depression (XML) | lower LOD (XML) ...
LLF ( in XML ) (145)
» Ligustri Lucidi Fructus (XML) | lung lavage fluid (XML) | lung lining fluid (XML) | leadership learning framework (XML) | lateral lingual foramen (XML) ...
LLDAS ( in XML ) (136)
» lupus low disease activity state (XML) | Low Lupus Disease Activity State (XML) | Lupus LDA State (XML) | Lupus Low Disease Activity State definition (XML) | low lupus disease activity status (XML)
LLND ( in XML ) (135)
» lateral lymph node dissection (XML) | LLN dissection (XML) | laparoscopic lymph node dissection (XML) | limited lymph node dissection (XML) | LLND- group (XML) ...
LLNM ( in XML ) (129)
» lateral lymph node metastasis (XML) | lateral LNM (XML) | lateral LN metastasis (XML) | LLN metastasis (XML)
LLQ ( in XML ) (128)
» lower limit of quantification (XML) | left lower quadrant (XML) | Low Luminance Questionnaire (XML) | Lake Louise Questionnaire (XML) | Laman & Lankhorst Questionnaire (XML) ...
LLDs ( in XML ) (127)
» lipid-lowering drugs (XML) | leg length discrepancies (XML) | living liver donors (XML) | long-lasting depolarizations (XML) | low-level descriptors (XML) ...
L-LTP ( in XML ) (127)
» late-phase long-term potentiation (XML) | late-phase LTP (XML) | late LTP (XML) | long-lasting long-term potentiation (XML) | long-lasting LTP (XML) ...
L. lactis ( in XML ) (124)
» Lactococcus lactis (XML) | Lactococcus lactis subsp. lactis (XML) | Lactobacillus lactis (XML) | Lactococcuslactis subsp. cremoris (XML)
LLCT ( in XML ) (114)
» ligand-to-ligand charge transfer (XML) | low-lying cerebellar tonsils (XML) | low load compression testing (XML) | lung-to-lung circulation time (XML) | longitudinal linear combination test (XML) ...
L-LA ( in XML ) (109)
» L-lactide (XML) | L-lactic acid (XML) | L (+)-lactide (XML) | L-lactic acidosis (XML) | L-lactide or polymeric P (XML) ...
LLRs ( in XML ) (109)
» laparoscopic liver resections (XML) | long-latency reflexes (XML) | large local reactions (XML) | long-leg radiographs (XML) | long-latency responses (XML) ...
LLs ( in XML ) (107)
» Landau levels (XML) | lower limbs (XML) | lowlanders (XML) | linear lesions (XML) | landfill leachates (XML) ...
LLG ( in XML ) (98)
» Landau-Lifshitz-Gilbert (XML) | lipid layer grade (XML) | log-likelihood gain (XML) | Leucaena leucocephala galactomannan (XML) | long-ranged lattice gas (XML) ...
LLLI ( in XML ) (95)
» low-level laser irradiation (XML) | lower-left lateral incisor (XML) | La Leche League International (XML) | lower-limb length inequality (XML) | lower limb lymphatic insufficiency (XML) ...
LLOQs ( in XML ) (88)
» lower limits of quantification (XML) | low quantification limits (XML)
L-L ( in XML ) (74)
» liquid-liquid (XML) | leading edge-to-leading edge (XML) | low supply-low demand (XML) | liver-limited (XML) | lumbosubarachnoid-lumboepidural (XML) ...
LLDN ( in XML ) (73)
» laparoscopic live donor nephrectomy (XML) | left LDN (XML) | laparoscopic LDN (XML) | Lateral lymph node dissection (XML) | living donor nephrectomies were performed with a laparoscopic technique (XML) ...
LLPCs ( in XML ) (70)
» long-lived plasma cells (XML) | long-lived PCs (XML) | long-lived, bone marrow-associated plasma cells (XML) | long-lived memory plasma cells (XML) | long-lived, immunoglobulin-secreting plasma cells (XML)
LLH ( in XML ) (70)
» laparoscopic left hemihepatectomy (XML) | long loops of Henle (XML) | low-level hemolysis (XML) | left laryngeal hemiplegia (XML) | long-lasting hyperpolarization (XML) ...
LLME ( in XML ) (65)
» liquid-liquid microextraction (XML) | L-leucyl-L-leucine methyl ester (XML) | L-leucine methyl ester (XML) | Leu-Leu-OMe (XML) | Leu-Leu-O-methyl ester (XML) ...
LLMICs ( in XML ) (65)
» low- and lower-middle-income countries (XML) | lower middle income countries (XML)
LLFDI ( in XML ) (63)
» Late-Life Function and Disability Instrument (XML) | late-life function and disability (XML) | Late-life Disability and Function Index (XML)
LLCP ( in XML ) (60)
» liquid-liquid critical point (XML) | lateral lamella of cribriform plate (XML) | lamella of the cribriform plate (XML) | lateral compression plate (XML) | linear LCP (XML) ...
LLB ( in XML ) (59)
» low-level blast (XML) | long leg braces (XML) | laparoscopic liver biopsy (XML) | laparoscopic lymph node biopsy (XML) | leaderless bacteriocins (XML) ...
LLFS ( in XML ) (59)
» Long Life Family Study (XML) | low lung function subgroup (XML)
LLNs ( in XML ) (58)
» lateral lymph nodes (XML) | lower limits of normal (XML) | lingual lymph nodes (XML) | liquid lipid nanoparticles (XML) | Low-Power and Lossy Networks (XML) ...
LLNL ( in XML ) (57)
» Lawrence Livermore National Laboratory (XML)
LLTs ( in XML ) (56)
» lipid-lowering therapies (XML) | lower lethal temperatures (XML) | Liquid-liquid transitions (XML) | lowest level terms (XML) | long leader transcripts (XML) ...
LLAs ( in XML ) (55)
» lower limb amputations (XML) | lipid-lowering agents (XML) | lower limb amputees (XML) | lateral lenticulostriate arteries (XML) | Lumbar lordortic angles (XML) ...
LLOs ( in XML ) (55)
» lipid-linked oligosaccharides (XML) | Li-rich layered oxides (XML) | Lithium-rich layered oxides (XML) | Lower limb orthoses (XML) | Li-rich layered oxides cathodes (XML) ...
LLPs ( in XML ) (51)
» long-lived proteins (XML) | lipoprotein-like particles (XML) | long-lived particles (XML) | lysozyme-like proteins (XML) | lipid layer patterns (XML) ...
LLVA ( in XML ) (49)
» low-luminance visual acuity (XML) | low-luminance VA (XML) | low-luminance best-corrected visual acuity (XML) | Lower limb vascular access (XML)
LLPT ( in XML ) (46)
» liquid-liquid phase transition (XML) | Left Leg Proprioception Test (XML)
LLPC ( in XML ) (45)
» long-lived plasma cells (XML) | left lateral parietal cortex (XML) | liquid-liquid partition chromatography (XML) | light-limited photocurrent density (XML) | lyso-lauroylphosphatidyl choline (XML) ...
L-LDH ( in XML ) (43)
» L-lactate dehydrogenase (XML) | LDH-like (XML) | L-lactic dehydrogenase (XML)
LLIs ( in XML ) (43)
» long-lived individuals (XML) | Leg length inequalities (XML) | life-limiting illnesses (XML) | lower-limb injuries (XML) | language-based learning impairments (XML) ...
l-LV ( in XML ) (40)
» l-leucovorin (XML) | levofolinate (XML) | levofolinate calcium (XML) | levoleucovorin (XML)
L-Lys ( in XML ) (39)
» L-lysine (XML) | L-lysine hydrochloride (XML)
LLMI ( in XML ) (37)
» lipid-laden macrophage index (XML) | lower limit of the measuring interval (XML) | Left lateral mitral isthmus (XML) | lipid-laden alveolar macrophage index (XML) | level, BMC was always negatively correlated with fat mass (XML) ...
LLW ( in XML ) (36)
» low-level radioactive waste (XML) | low level waste (XML) | Landrace-Large White (XML) | liquid/liquid optical waveguide (XML) | left lung weight (XML) ...
LLSM ( in XML ) (36)
» lattice light-sheet microscopy (XML) | linear-linear sire-maternal grandsire (XML) | Laparoscopic lateral suspension with mesh (XML) | linear limited sampling model (XML)
LL-BFR ( in XML ) (35)
» low-load blood flow restriction (XML) | low-load resistance exercise with blood flow restriction (XML) | low load combined with blood flow restriction (XML) | low-load BFR (XML) | LL-RT with blood flow restriction (XML) ...
LLLS ( in XML ) (35)
» laparoscopic left lateral sectionectomy (XML) | laparoscopic LLS (XML) | low-level laser stimulation (XML) | local linearized least squares (XML) | liver left lateral section (XML) ...
LLT1 ( in XML ) (33)
» lectin-like transcript 1 (XML) | CD161-Lectin-like Transcript 1 (XML) | LLT1TC (XML)
LLAEP ( in XML ) (28)
» long-latency auditory evoked potentials (XML) | long-latency auditory event-related potential (XML) | Long Latency Evoked Potentials (XML) | long latency AEP components (XML) | long latency AEPs (XML) ...
LLAR ( in XML ) (27)
» laparoscopic low anterior resection (XML) | laparoscopic LAR (XML) | low-level Azi-R SPN (XML) | lower level of autoregulation (XML) | left LAR (XML) ...
LLDS ( in XML ) (27)
» Lifelines Diet Score (XML) | lower level of depressive symptoms (XML) | laser-light diffraction spectroscopy (XML) | Local Lift Dependence Scale (XML) | low liver-damage strategy (XML) ...
LLTS ( in XML ) (27)
» Low-level tragus stimulation (XML) | low-level transcutaneous electrical stimulation (XML) | low-level, transcutaneous stimulation of vagus nerve at the tragus (XML) | landfill leachate treatment station (XML) | lowest-lying triplet state (XML) ...
LLU ( in XML ) (27)
» Loma Linda University (XML) | leukocyte ultrafiltrate (XML) | lower limb ulcers (XML) | Lipoleiomyoma of the uterus (XML) | liver lactate uptake (XML) ...
L-Leu ( in XML ) (27)
» L-leucine (XML) | L-Leu-Leu (XML) | L-leucine polypeptides (XML)
LLPDD ( in XML ) (25)
» late luteal phase dysphoric disorder (XML)
LLST ( in XML ) (25)
» limitation of life-sustaining treatment (XML) | limitation of life support treatment (XML) | laser light scattering techniques (XML) | left lateral segment liver transplantation (XML) | legs lean soft tissue (XML) ...
LLSs ( in XML ) (23)
» long-lived states (XML) | long-lived spin states (XML) | lumen-like structures (XML) | liquid-like surfaces (XML) | Lake Louise scores (XML) ...
LLSCC ( in XML ) (23)
» lower lip squamous cell carcinoma (XML) | lower lip SCC (XML)
LLRT ( in XML ) (23)
» low-load resistance training (XML) | Linear linking for related traits (XML) | lower-limb robot training (XML) | lower-load RT (XML) | low-intensity, long-wavelength red light therapy (XML) ...
LLnL ( in XML ) (22)
» N-acetyl-L-leucyl-L-leucyl-L-norleucinal (XML) | N-Acetyl-Leu-Leu-Norleu-al (XML)
l-LA ( in XML ) (21)
» l-lactide (XML)
LLMS ( in XML ) (21)
» Lower limb muscle strength (XML) | Lower Limb Model for Safety (XML) | long lateral mass screws (XML) | Laparoscopic liver mono-segmentectomy (XML) | Longitudinal Labor Market Study (XML) ...
LLDI ( in XML ) (21)
» Late Life Disability Instrument (XML) | Late Life Disability Index (XML) | Late Life Function and Disability Instrument (XML) | labiolingual dysfunction index (XML) | L-lysine diisocyanate (XML)
LLTI ( in XML ) (21)
» limiting long-term illness (XML) | l-lysine triisocyanate (XML) | long-standing illness (XML)
LLAC ( in XML ) (21)
» lower limb arterial calcification (XML) | lupus-like anticoagulant (XML) | liquid-liquid extraction followed by acidic hydrolysis (XML) | lingual augmented corticotomy (XML) | L-lactic acid concentration (XML)
LLCI ( in XML ) (20)
» lower limb critical ischaemia (XML) | lower limb comfort index (XML) | lower limit confidence interval (XML) | lower limits of the CI (XML)
LLPA ( in XML ) (20)
» low levels of physical activity (XML) | low light-intensity physical activity (XML) | left lateral para-aortic (XML) | leisure PA during the lifespan (XML) | Loveland Living Planet Aquarium (XML) ...
LLSS ( in XML ) (19)
» Lake Louise Scoring System (XML) | Lake Louise Symptom Score (XML) | laparoscopic liver skills scale (XML) | lotus leaf surface structure (XML) | low laminar shear stress (XML) ...
LLCA ( in XML ) (19)
» longitudinal latent class analysis (XML) | lower limit of cerebral autoregulation (XML) | Loneliness Scale for Children and Adolescents (XML) | lip line cant angle (XML) | last Legionellales common ancestor (XML) ...
LLLME ( in XML ) (19)
» liquid-liquid-liquid microextraction (XML)
LLFI ( in XML ) (19)
» Lower Limb Functional Index (XML) | low LFI (XML) | LFI score: low (XML) | Late Life Function Instrument (XML)
LLOV ( in XML ) (18)
» Lloviu virus (XML) | Lloviu cuevavirus (XML)
LLMIC ( in XML ) (18)
» low and lower-middle income countries (XML) | lower middle income countries (XML) | low and lower middle income (XML)
LL-37 ( in XML ) (18)
» leucine-leucine-37 (XML) | [LL-37, 37 aa] (XML) | leucin-leucin-37 (XML) | LL-37 peptide (XML)
LLoQ ( in XML ) (17)
» lower limit of quantitation (XML) | lower limits of quantification (XML)
LLITNs ( in XML ) (17)
» long-lasting insecticide-treated nets (XML) | long-lasting-insecticide-treated bed nets (XML)
LLCS ( in XML ) (17)
» Lower Limb Core Scale (XML) | lower limb compartment syndrome (XML) | landfill-leachate-contaminated soils (XML) | leader-laggard chaos synchronization (XML) | Lake Louise Clinical score (XML) ...
LLLs ( in XML ) (17)
» lumenless leads (XML) | low-level lasers (XML) | lumen-less pacing leads (XML) | late lumen losses (XML) | Luminescent lanthanide labels (XML) ...
LL-VNS ( in XML ) (17)
» low-level vagus nerve stimulation (XML) | low-level VNS (XML) | low-level vagosympathetic stimulation (XML)
LLIP ( in XML ) (17)
» liquid-liquid interfacial precipitation (XML) | Long Lead Initial pulse (XML)
LLDA ( in XML ) (17)
» Local Linear Discriminant Analysis (XML) | labeled latent Dirichlet allocation (XML) | low level disease activity (XML) | laser light diffusing area (XML) | Laguna Lake Development Authority (XML) ...
LLAT ( in XML ) (17)
» left lateral (XML) | lateral from the left side to the right side (XML)
ll ( in XML ) (16)
» long-allele homozygotes (XML) | l l $(epsilon)_ (XML) | littleleaf (XML) | limbless (XML) | lamella-lamella (XML) ...
Ll ( in XML ) (16)
» longissimus lumborum (XML) | labeling index (XML) | Loa loa (XML) | Locator light retention (XML) | Lisch-like (XML) ...
LLSR ( in XML ) (16)
» long-latency stretch reflex (XML) | long latency stretch response (XML) | linear least squares regression (XML) | lung-liver signal ratio (XML) | local laparotomic stomal reconstruction (XML) ...
LLDP ( in XML ) (16)
» left lateral decubitus position (XML) | liquid-liquid displacement porosimetry (XML) | link layer discovery protocol (XML) | lateral laparoscopic distal pancreatectomy (XML) | Lateral lumbar disc prosthesis (XML)
LLAS ( in XML ) (16)
» Lower Limb Assessment Score (XML) | lower limb assessment scale (XML) | LENA Language Autism Screen (XML) | Leadership Learning Agility Scale (XML) | lower limb atherosclerosis (XML) ...
LLSAN ( in XML ) (16)
» levator labii superioris alaeque nasi (XML) | labii superioris alaeque nasi muscle (XML) | LLS alaeque nasi (XML)
LLHR ( in XML ) (15)
» low-load, high-repetition (XML) | linear-linear homologous recombination (XML) | leg-length-to-height ratio (XML) | linear homologous recombination-mediated recombineering (XML) | lighter load, higher repetitions (XML) ...
LLTP ( in XML ) (15)
» large lipid transfer protein (XML) | landfill leachate treatment plant (XML) | late-stage LTP (XML)
LLPM ( in XML ) (14)
» layered learning practice model (XML) | leadless pacemaker (XML) | linear length of a positive margin (XML)
LLRW ( in XML ) (14)
» low-level radioactive waste (XML) | low-level radioactive laboratory waste (XML) | low-level radioactive liquid waste (XML)
LLRE ( in XML ) (14)
» low-load resistance exercise (XML) | liquid-liquid refining extraction (XML) | low-level radioactive effluents (XML) | late light response element (XML)
LLE-LTP ( in XML ) (14)
» liquid-liquid extraction with low temperature purification (XML)
LLSI ( in XML ) (14)
» limiting long-standing illness (XML) | limiting long-standing illness or disability (XML) | low levels of SIVmne infection (XML) | laser-liquid-solid interaction (XML) | Local Latent Semantic Indexing (XML) ...
LLSVPs ( in XML ) (14)
» large low-shear-velocity provinces (XML)
LLEs ( in XML ) (14)
» lower limb exoskeletons (XML) | largest Lyapunov exponents (XML) | lower limb events (XML) | low-loss electrons (XML) | lotus leaf extracts (XML) ...
l-Lys ( in XML ) (14)
» l-lysine (XML)
LLTO ( in XML ) (14)
» lithium lanthanum titanium oxide (XML) | Li3xLa2/3-xTiO3 (XML) | lithium lanthanum titanate, La2/3-xLi3xTiO3 (XML) | Li(3x)La(2/3-x)TiO3 (XML) | Li-La-Ti-O (XML) ...
LLAEPs ( in XML ) (13)
» long latency auditory evoked potentials (XML)
LLTM ( in XML ) (13)
» linear logistic test model (XML) | low lean tissue mass (XML) | long-lasting long-term memory (XML) | Late Lutetian Thermal Maximum (XML) | Linear Logistic Test Model(s) (XML) ...
LLMD ( in XML ) (13)
» late-life major depression (XML) | Lyme-literate medical doctor (XML) | late-life mortality deceleration (XML) | late-life major depressive disorder (XML)
LLSIR ( in XML ) (13)
» lung-to-liver signal intensity ratio (XML) | lung/liver SIR (XML)
LLITN ( in XML ) (12)
» Long-lasting insecticide-treated bed nets (XML) | long-lasting insecticide treated mosquito nets (XML) | long-lasting insecticidal net (XML)
LLUMC ( in XML ) (12)
» Loma Linda University Medical Center (XML)
LLIS ( in XML ) (12)
» Lymphedema Life Impact Scale (XML) | Long-lasting insecticidal net screens (XML)
LLk ( in XML ) (12)
» low likelihood (XML)
LLCR ( in XML ) (12)
» lifetime lung cancer risk (XML) | lowland C. rotundus (XML) | liver metastases and colorectal cancer (XML) | liver-to-lesion contrast ratio (XML) | Lower lateral cartilage repositioning (XML) ...
LLJ ( in XML ) (12)
» low-level jet (XML) | leaves of L. japonica (XML) | latero-lateral joint (XML) | laterale-jeffersonianum (XML)
LL'CT ( in XML ) (11)
» ligand-to-ligand charge transfer (XML) | LPtL', reveal charge-separated dichalcogenolene diimine charge-transfer (XML)
LLRA ( in XML ) (11)
» low lateral right atrium (XML) | low-luminance binocular reading acuity (XML) | Logistic Model with Relaxed Assumptions (XML) | low lateral RA (XML)
LLTL ( in XML ) (11)
» live low-train low (XML) | living low-training low (XML) | level with regular training only (XML) | living in normoxia with no additional maximal-intensity exercise (XML)
LLCER ( in XML ) (11)
» lesion-to-liver contrast enhancement ratio (XML) | liver-to-lesion contrast enhancement ratio (XML)
LLAD ( in XML ) (11)
» lower limb atherosclerosis disease (XML) | lower limb arterial disease (XML) | late-life anxiety disorders (XML) | Luer-Lok Access Device (XML) | longitudinal left atrial (XML) ...
LLDH ( in XML ) (11)
» lateral lumbar disc herniation (XML) | laparoscopic living donor hepatectomy (XML) | living liver donor hepatectomy (XML) | lateral living donor hepatectomy (XML)
LLHT ( in XML ) (11)
» ligand-to-ligand hydrogen transfer (XML) | ligand-to-ligand H-transfer (XML)
LLIR ( in XML ) (11)
» laminin-like immunoreactivity (XML) | look-locker inversion recovery (XML) | linearized local impulse response (XML) | Long-term low-dose ionizing radiation (XML) | laparoscopic loop ileostomy reversal (XML) ...
LLC-PK1 ( in XML ) (11)
» Lilly Laboratories cell-porcine kidney 1 (XML) | Lewis lung carcinoma-porcine kidney-1 (XML) | Laboratories cell-porcine kidney 1 epithelial cells (XML) | LLC-Pig Kidney 1 (XML)
LLCZ ( in XML ) (10)
» luliconazole (XML)
L-LR ( in XML ) (10)
» L-isomer only (XML) | L-lactated Ringer's (XML) | L-isomer of lactate (XML) | LLS, LH, RH (XML) | Leptin-Leptin receptor (XML) ...
LLOA ( in XML ) (10)
» lower limb osteoarthritis (XML) | Laparoscopic lysis of adhesions (XML) | lower limit of agreement (XML) | lower lateral orbital angle (XML)
l-Leu ( in XML ) (9)
» l-leucine (XML)
LLMDA ( in XML ) (9)
» Lawrence Livermore Microbial Detection Array (XML)
L-LCNEC ( in XML ) (9)
» Lung large cell neuroendocrine carcinoma (XML) | large-cell neuroendocrine carcinoma of the lung (XML)
LLTPs ( in XML ) (9)
» large lipid transfer proteins (XML) | landfill leachate treatment plants (XML)
LLRP ( in XML ) (9)
» lower limb rehabilitation protocol (XML) | lower leg radiating pain (XML) | lower Liaohe River Plain (XML) | lower lid retractor plication (XML)
LLCD ( in XML ) (9)
» large liver cell dysplasia (XML) | Liver cell dysplasia of large (XML) | Leadership Learning and Career Development (XML) | liquid low-calorie diet program (XML)
LLBs ( in XML ) (9)
» Lidocaine-Loaded Bands (XML) | lidocaine-impregnated ligation bands (XML) | Lanthanide Luminescent Bioprobes (XML) | Leaderless bacteriocins (XML) | liquid lithium batteries (XML) ...
LLSPR ( in XML ) (9)
» longitudinal localized surface plasmon resonance (XML)
L-lep ( in XML ) (8)
» lepromatous leprosy (XML)
LLFC ( in XML ) (8)
» life-limiting fetal condition (XML) | liver fat (LFC) after calving in low (XML) | low liver fat content (XML)
LLSF ( in XML ) (8)
» Linear Least Squares Fit (XML) | linear least squares fitting (XML) | large Laplacian spatial filter (XML) | linear least-squares fitting method (XML)
LLUH ( in XML ) (8)
» Loma Linda University Health (XML)
LLA-CL ( in XML ) (8)
» Lichtenstein inguinal hernia repair using electrospun P (XML) | loading with the Wnt signal pathway inhibitor ICG-001, the Collagen/P (XML) | (l-lactic acid-co--caprolactone) P (XML) | CIF-loaded fibers made solely of P (XML) | long-term follow-ups, anterior pelvic reconstruction surgery with a P (XML) ...
LLE-GC-MS ( in XML ) (8)
» liquid-liquid extraction-gas chromatography-mass spectrometry (XML)
LLCH ( in XML ) (8)
» low level continuous heat (XML) | localized Langerhans cell histiocytosis (XML) | Langerhans cell histiocytosis (XML) | Landfill leachate (XML) | localised LCH (XML)
LLBA ( in XML ) (8)
» Linguistics and Language Behavior Abstracts (XML) | load in bronchoalveolar lavage fluid (XML)
LLAM ( in XML ) (8)
» lipid-laden alveolar macrophages (XML) | linear-linear animal (XML) | lipid-laden macrophage (XML)
LLK ( in XML ) (8)
» locally linear K Nearest Neighbor (XML) | likelihood of CAD (XML) | likelihood (XML) | Laser Lok (XML) | log-likelihood (XML) ...
LLRS ( in XML ) (8)
» lumbar lateral recess stenosis (XML) | Limb Lengthening and Reconstruction Society (XML) | Large Lakes Research Station (XML) | low-level radioactive samples (XML) | lunar laser ranging system (XML) ...
LLFR ( in XML ) (8)
» lunate-lunate facet ratio (XML) | long latency flexor reflex (XML) | lower limb flexion reflex (XML) | low-level fosfomycin resistance (XML) | long-latency feedback response (XML) ...
LL2 ( in XML ) (8)
» large loop 2 (XML) | lower limb pattern 2 (XML) | Lewis lung carcinoma 2 (XML) | lymphomas using the rapidly internalizing antibody, anti-CD22 (XML) | LICR-LON-HMy2 (XML) ...
LLZO ( in XML ) (8)
» lithium lanthanum zirconium oxide (XML) | lithium lanthanum zirconate (XML) | Li-La-zirconate (XML) | Li7 La3 Zr2 O12-d (XML) | Li7-xLa3-aZr2-bO12 (XML)
LLRC ( in XML ) (8)
» limb-loss rehabilitation continuum (XML) | Latino legal residents/citizens (XML) | limb loss rehabilitation continuum framework (XML) | locally recurrent rectal cancer (XML) | Locally Linear Representation-based Classification (XML) ...
LLRL ( in XML ) (8)
» low-level red light (XML) | low-level red laser (XML)
LLINEUP ( in XML ) (8)
» LLIN Evaluation in Uganda Project (XML)
LLES ( in XML ) (8)
» lower lumbar erector spinae (XML) | lower limb explosive strength (XML) | lower limb exoskeleton (XML) | low-lying metal-centered electronic states (XML) | low-lying excited states (XML) ...
LLRR ( in XML ) (8)
» lower limb rehabilitation robot (XML) | Laplacian regularized Low-Rank Representation (XML) | latent low-rank representation referred (XML) | left-left-right-right (XML) | lower limb robotic rehabilitation (XML) ...
LLBNs ( in XML ) (8)
» long-lead burst neurons (XML)
LLTC ( in XML ) (7)
» lower-level trauma centers (XML) | lateral line trunk canal (XML) | line or a tissue culture-adapted cell line (XML) | lower limb trauma coordinator (XML) | laparoscopic Ligamentum Teres Cardiopexy (XML)
LLKS ( in XML ) (7)
» Lymphangioma-like Kaposi's sarcoma (XML) | lymphangioma-like KS (XML)
LL3 ( in XML ) (7)
» LITAF-like 3 (XML) | late L3 (XML) | LUX-Lung 3 (XML) | lung-stage L3 (XML) | lipopolysaccharide-induced tumor necrosis factor-alpha transcription factor 3 (XML) ...
LLSQ ( in XML ) (7)
» linear least-squares (XML) | Lake Louise Score Questionnaire (XML)
LL-TK ( in XML ) (7)
» lumbar lordosis minus thoracic kyphosis (XML) | LL minus TK (XML)
LL-TS ( in XML ) (7)
» low-level tragus stimulation (XML)
L-L SUV R ( in XML ) (7)
» lesion to liver SUVmax ratio (XML)
LLC-NPs ( in XML ) (7)
» lyotropic liquid crystal nanoparticles (XML) | low lipid core-nanoparticles (XML)
LLDC ( in XML ) (7)
» Langerhans-like dendritic cells (XML) | Langerhans-like DC (XML) | LC-like dendritic cells (XML) | large, less-dense cells (XML) | lower limit of detectable concentration (XML) ...
LLVV ( in XML ) (7)
» lower limb varicose veins (XML)
LLLD ( in XML ) (7)
» lower limb length discrepancy (XML) | laparoscopic lateral lymph node dissection (XML) | long-label long-delay (XML) | localized-liquid-liquid-diffusion (XML) | lobar lung living-donors (XML)
LLBFR ( in XML ) (7)
» low-load blood flow restriction (XML) | low load training with BFR (XML) | low-load exercise with BFR (XML)
LLLA ( in XML ) (7)
» Low-level laser acupuncture (XML) | left lower lobe atelectasis (XML) | lower limb loading ability (XML) | lower lumbar lordosis angle (XML)
lly ( in XML ) (7)
» legiolysin (XML) | legiolysin gene (XML) | laboratory, legiolysin (XML)
LLPP ( in XML ) (6)
» left lateroportal process (XML) | lymph lipid precursor pool (XML) | LPP in a linear distribution (XML)
LLCa ( in XML ) (6)
» Lewis lung carcinoma (XML) | Lewis Lung carcinoma cells (XML)
LLER ( in XML ) (6)
» position-lower limb external rotation (XML) | lowlevel of experience region (XML) | low level electromagnetic radiation (XML) | least evolutionary resistance (XML) | Lost Life Expectancy Rate (XML)
LLPTs ( in XML ) (6)
» liquid-liquid phase transitions (XML)
L-LMC ( in XML ) (6)
» lumbar lateral motor column (XML)
l-LNvs ( in XML ) (6)
» large ventrolateral neurons (XML) | large lateral ventral clock neurons (XML)
LLRM ( in XML ) (6)
» Laplacian-likelihood-ratio method (XML) | Low Level of Response Model (XML) | lamina and ligament repair model (XML) | LASSO logistic regression model (XML) | Lasso-Logistics prediction model (XML)
ll-DAP ( in XML ) (6)
» ll-diaminopimelic acid (XML) | l-lysine diaminopimelic acid (XML)
lLNvs ( in XML ) (6)
» large LNvs (XML) | large lateral ventral neurons (XML) | Large lateral ventral arousal neurons (XML) | large ventral-lateral neurons (XML)
LLCPs ( in XML ) (6)
» liquid-liquid critical points (XML) | long-lived climate pollutants (XML) | linear liquid crystal polymers (XML) | Luminescent liquid crystalline polymers (XML) | Lyotropic liquid crystalline phases (XML)
LLNR ( in XML ) (6)
» lateral lymph node recurrence (XML) | lateral-compartment LNR (XML)
LLMC ( in XML ) (6)
» landfill leachate membrane concentrate (XML) | liquid-liquid membrane contactor (XML) | lipid-laden multilocular cells (XML)
L-LPS ( in XML ) (6)
» leptospiral lipopolysaccharide (XML) | Leishmania lipopolysaccharide (XML)
LLX ( in XML ) (6)
» liquid-liquid extraction (XML) | leader-leader exchange (XML)
LLaMA ( in XML ) (6)
» large language model meta-AI (XML) | LLM-based approach (XML) | Language Learning and Meaning Acquisition (XML)
LLGR ( in XML ) (6)
» lower leg growth rate (XML)
LLSA ( in XML ) (6)
» lower lobe segmental artery (XML) | Lifelong Learning and Self-assessment (XML) | liquid-liquid two-phase self-assembly (XML) | local linear scaling approximation (XML) | low-dose low-specific-gravity spinal anesthesia (XML) ...
LL-CBS ( in XML ) (6)
» low-level carotid baroreceptor stimulation (XML) | low-level CBS (XML)
l-LDH ( in XML ) (6)
» l-lactate dehydrogenase (XML)
LLHA ( in XML ) (6)
» lower lingual holding arch (XML)
LLLR ( in XML ) (6)
» low-level laser radiation (XML) | lateral segment liver resection (XML) | laparoscopic limited liver resections (XML)
LLNAs ( in XML ) (6)
» local lymph node assays (XML)
LLIE ( in XML ) (6)
» Low-light image enhancement (XML)
LLG1 ( in XML ) (6)
» LORELEI-like-GPI-anchored protein 1 (XML) | Lorelei-Like Glycoprotein 1 (XML) | (LRE)-LIKE GLYCOSYLPHOSPHATIDYLINOSITOL (GPI)-ANCHORED PROTEIN 1 (XML) | LRE-like GPI-AP1 (XML)
LLOM ( in XML ) (6)
» lower-limb osteomyelitis (XML) | Leu-Leu-O-methyl (XML) | low-level LOM (XML) | lower lip oral mucosa (XML)
LLFs ( in XML ) (6)
» lower limb fractures (XML) | lipofuscin-like fluorophores (XML) | line-like features (XML) | lateral LFs (XML) | low lumbar fractures (XML)
LLC-PK ( in XML ) (6)
» LLC porcine kidney (XML) | Lily Laboratory Culture, Porcine Kidney (XML)
LLCC ( in XML ) (6)
» Large liver cell change (XML) | Lewis lung carcinoma cells (XML) | lifelong chronic conditions (XML) | life-long cardiac care (XML)
LLAPs ( in XML ) (6)
» Legionella-like amoebal pathogens (XML)
LLGP ( in XML ) (6)
» lentil lectin purified glycoprotein (XML) | lentil-lectin-purified glycoproteins from T. solium Ag (XML) | lentil lectin-bound glycoproteins (XML)
LL1 ( in XML ) (5)
» Longlin 1 (XML) | large loop 1 (XML) | lower limb pattern 1 (XML) | L1210 murine leukemia cells (XML) | LOTUS LEAF 1 (XML)
LLNP ( in XML ) (5)
» local lymph node proliferation assay (XML) | lower leg negative pressure (XML) | LiLa(1-x)Nd(x)(PO(3))(4) (XML) | Lachua National Park (XML)
LLP2 ( in XML ) (5)
» lentivirus lytic peptide 2 (XML)
LLE-SPE ( in XML ) (5)
» liquid-liquid extraction followed by solid-phase extraction (XML)
LLTRD ( in XML ) (5)
» late-life treatmentresistant depression (XML)
LLZ ( in XML ) (5)
» low-lying mountain zone (XML) | low-lying zone (XML) | LL-Z1640-2 (XML) | Lilizhi (XML) | Lower-Longevity Zone (XML)
LLCM ( in XML ) (5)
» lyotropic liquid crystalline mesophases (XML) | Lewis Lung Carcinoma conditioned media (XML) | Low-Latency, Continuous-Motion (XML) | light-chain myeloma (XML)
LLLV ( in XML ) (5)
» lower leg length velocity (XML) | LLL velocity (XML)
LLDF ( in XML ) (5)
» low-level data fusion (XML) | Longitudinal Log-Demons Framework (XML)
LLHD ( in XML ) (5)
» low latency and high data rate (XML) | lean-led hospital design (XML) | left lateral hepatic duct (XML)
LLLH ( in XML ) (5)
» laparoscopic left lateral hepatectomy (XML) | Longitudinal Late-Life Health study (XML)
LLAF ( in XML ) (5)
» lipofuscin-like autofluorescence (XML) | long leg alignment films (XML)
LLTE ( in XML ) (5)
» lower leg trajectory error (XML) | listening and treatment explanations (XML)
LLPL ( in XML ) (5)
» LCAT-like lysophospholipase (XML) | lower-leg proprioceptive loss (XML) | acyltransferase-like lysophospholipase (XML) | limited laparoscopic pelvic lymphadenectomy (XML)
LL-DAP-AT ( in XML ) (5)
» LL-diaminopimelate aminotransferase (XML)
LLQR ( in XML ) (5)
» low-level quinolone resistance (XML)
LLCPA ( in XML ) (5)
» lateral lamella-cribriform plate angle (XML) | lateral lamella CP angle (XML) | lateral lamella and cribriform plate (XML) | lamella and the cribriform plate (XML)
LLOS ( in XML ) (5)
» Lower Leg Outcome Survey (XML) | long length of stay (XML) | lower-limb orthopedic surgery (XML) | liver transplantation (XML)
lll ( in XML ) (5)
» little with extractant, which implies that most of the Fe (XML) | likely to play a major role in Fe (XML) | ligands are able to selectively extract Am (XML) | ligands with variable conditional stability constants for Fe (XML) | largely determined by the filterability of Cr (XML)
LLDRH ( in XML ) (5)
» laparoscopic living donor right hemihepatectomy (XML)
LLEC ( in XML ) (5)
» Leptomeningeal Lymphatic Endothelial Cells (XML) | Landfill leachate evaporation concentrate (XML) | L,L, ethylenedicysteine (XML) | long-lived effector cells (XML) | label-less learning for emotion cognition (XML)
LLVD ( in XML ) (5)
» lower-limb varicose disease (XML) | locoregional lung ventilation distribution (XML) | lower limb vascular disease (XML) | lower limb venous Duplex (XML)
LLODs ( in XML ) (5)
» lower limits of detection (XML)
lldD ( in XML ) (5)
» L-lactate dehydrogenase (XML) | L-lactate dehydrogenase gene from Escherichia coli (XML)
LLTT ( in XML ) (5)
» low level technology tool (XML) | low-level laser treatment (XML) | low-level treadmill tests (XML) | Longiflorum x Trumpet hybrid (XML)
lle ( in XML ) (5)
» long, located between rrnS and tRNA (XML) | low levels of estrogen (XML) | lower lens-eye (XML) | L. striatellus was found between srRNA and tRNA (XML)
LLTA ( in XML ) (5)
» long-lasting tonic activation (XML) | laparoscopic-assisted left thoracoabdominal esophagectomy (XML) | laparoscopic liver tumor ablation (XML)
LLy ( in XML ) (5)
» lymphoblastic lymphoma (XML)
LLP-1 ( in XML ) (5)
» lentivirus lytic peptide 1 (XML) | lentivirus lytic peptides segment 1 (XML) | lentiviral lytic peptide type 1 (XML)
L-L IBR ( in XML ) (5)
» liquid-liquid interface bioreactor (XML)
LLVR ( in XML ) (5)
» Laparoscopic low ventral rectocolpopexy (XML) | Late LVR (XML) | left renal vein (XML) | lens thickness, real vitreous chamber depth and retinal thickness (XML) | low-level viral rebound (XML)
LLPI ( in XML ) (5)
» long-lasting permethrin impregnated (XML) | long-lasting protection inducer (XML)
LLZTO ( in XML ) (4)
» LiLaZrTaO (XML) | PVDF-HFP-LiClO4-Li6.4La3Zr1.4Ta0.6O12 (XML) | lithium lanthanum zirconate (XML) | lithium lanthanum zirconium oxide (XML)
LLRD ( in XML ) (4)
» long-lived radioactive dust (XML) | life-limiting rare diseases (XML) | long-latency respiratory disease (XML)
LLY ( in XML ) (4)
» lectinolysin (XML) | LandraceLandraceYorkshire (XML) | lost life-years (XML)
LLC1 ( in XML ) (4)
» Lewis lung carcinoma 1 (XML) | Lewis lung cancer 1 (XML)
LLBO ( in XML ) (4)
» Laser Light-Based Opacitometer (XML)
LLFP ( in XML ) (4)
» long-lived fission products (XML) | ligamentum flavum process (XML) | Label Fuzzy Proportions (XML) | LLF pneumonia (XML)
LLABCs ( in XML ) (4)
» locally advanced breast cancers (XML)
LLMB ( in XML ) (4)
» lower limb motor blocks (XML) | low-lying muscle belly (XML) | Low-lying peroneus brevis muscle belly (XML)
LLFTB ( in XML ) (4)
» lower lung field tuberculosis (XML) | lower-lung-field TB (XML)
LLGL2 ( in XML ) (4)
» lethal giant larvae 2 (XML) | Lethal giant larvae homolog 2 (XML) | larvae homolog 2 (Drosophila) (XML)
LLFE ( in XML ) (4)
» Leucas lavandulaefolia (XML) | lotus leaf flavonoid extract (XML) | Ligustrumlucidum fruit extract (XML)
LLPR ( in XML ) (4)
» linearized local perturbation response (XML) | Limb Loss and Preservation Registry (XML) | Lower limb power rehabilitation (XML) | large-lesion-poor-recovery (XML)
LLMP ( in XML ) (4)
» lower limb movement patterns (XML) | log-linear model with Poisson distribution (XML) | lower limit of melodic pitch (XML) | lower limb muscle power (XML)
LLIFs ( in XML ) (4)
» lateral lumbar interbody fusions (XML) | lateral lumbar intervertebral fusions (XML)
L. luteola ( in XML ) (4)
» Lymnaea luteola (XML)
LLSV ( in XML ) (4)
» low ligation of spermatic vessels (XML) | left lateral segment volume (XML) | leg large subcutaneous vein (XML)
LLC-SD ( in XML ) (4)
» LLC-Symmetric Division (XML) | Lewis lung adenocarcinoma SD (XML) | largely symmetric division for self-renewal (XML)
LLBW ( in XML ) (4)
» lighter low birth weight (XML) | lung, liver, and body weights (XML) | Lingual, labial and buccal weakness (XML)
LLPMs ( in XML ) (4)
» Leadless pacemakers (XML) | leadless cardiac pacemakers (XML)
LL-EPI ( in XML ) (4)
» Look-Locker echo-planar imaging (XML) | Look-Locker EPI (XML)
LLS1 ( in XML ) (4)
» LATERAL LEAFLET SUPPRESSION1 (XML) | LETHAL LEAF SPOT1 (XML) | Lateral Leaflet Suppression 1 (XML) | lethal leaf spot 1 (XML)
LL/BL ( in XML ) (4)
» lepromatous/borderline lepromatous (XML) | leprosy/borderline leprosy (XML)
LLMPP ( in XML ) (4)
» Leukemia/Lymphoma Molecular Profiling Project (XML) | Lymphoma/Leukemia Molecular Profiling Project (XML)
LLCPS ( in XML ) (4)
» liquid-liquid crystalline phase separation (XML)
LLSC ( in XML ) (4)
» lumbar spinal canal (XML) | Living Lab on Sharing and Circular Economy (XML) | lateral lumbar spinal canal (XML) | long-lasting Silastic catheter (XML)
LLPUs ( in XML ) (4)
» lower limb prosthesis users (XML)
LLAMA ( in XML ) (4)
» Lead-Likeness and Molecular Analysis (XML) | Lyman-Alpha Measurement Apparatus (XML)
LLSG ( in XML ) (4)
» large litter size group (XML) | laser light-scattering granulometer (XML) | left lateral segment graft (XML) | lower lumbar stability group (XML)
LLP3 ( in XML ) (4)
» lentiviral lytic peptide 3 (XML) | lentiviral lytic peptide-3 motif (XML)
LLMT ( in XML ) (4)
» lower lid margin thickness (XML)
LLFDI-CAT ( in XML ) (4)
» Late-Life Function and Disability Instrument Computer Adaptive Test (XML)
LLTH ( in XML ) (4)
» live-low train-high (XML) | living low-training high (XML) | living-low and training-high (XML)
LLHs ( in XML ) (4)
» low-level heuristics (XML) | layered lanthanide hydroxides (XML)
L-LMICs ( in XML ) (4)
» low- and lower-middle-income countries (XML) | low-income or lower-middle-income countries (XML)
LLCNs ( in XML ) (4)
» lipid liquid crystalline nanoparticles (XML)
LLSCCs ( in XML ) (4)
» lower lip squamous cell carcinomas (XML)
LLPO ( in XML ) (4)
» long-lived photooxidants (XML)
LLMR ( in XML ) (4)
» low-level mupirocin resistance (XML) | lower limb muscle ratio (XML)
L. Lactis ( in XML ) (4)
» lactococcus lactis (XML) | Leuconostoc lactis (XML)
LLMCs ( in XML ) (4)
» landfill leachate membrane concentrates (XML) | Liquid-liquid membrane contactors (XML)
LLSimpute ( in XML ) (4)
» local least squares imputation (XML)
LLGs ( in XML ) (4)
» legume lost genes (XML) | left lobe grafts (XML) | local liver grafts (XML) | larger litter size groups (XML)
lld ( in XML ) (4)
» leaflet development (XML) | lower level discriminators (XML)
LLCE ( in XML ) (4)
» liquid-liquid cartridge extraction (XML) | lower limbs cycle ergometer (XML) | liquid-liquid continuous extraction (XML)
LLT-ESP ( in XML ) (4)
» low-low temperature electrostatic precipitator (XML)
LLIH ( in XML ) (4)
» long-lasting insecticidal hammocks (XML) | long-lasting insecticide-treated hammock (XML)
l-LPM ( in XML ) (4)
» left lateral plate mesoderm (XML)
LLOMe ( in XML ) (4)
» Leu-Leu-OMe (XML) | l-leucyl-l-leucine O-methyl ester (XML)
LLAPTR ( in XML ) (3)
» Long-lasting allergic patch test reactions (XML)
LLUS ( in XML ) (3)
» late leakage of undetermined source (XML)
LLBT ( in XML ) (3)
» lasers and light-based therapies (XML) | log-linear Bradley-Terry (XML)
LLRT-BFR ( in XML ) (3)
» low-load resistance training with blood flow restriction (XML)
LLABC ( in XML ) (3)
» locally advanced breast cancer (XML) | LL resin was additionally tested with an air-barrier coating (XML)
LLVS ( in XML ) (3)
» low-level vagus nerve stimulation (XML) | low-luminance visual stimulation (XML) | low-level vagosympathetic trunk stimulation (XML)
LLFT ( in XML ) (3)
» lower-limb fatigue (XML) | locally leptokurtic and fat-tailed (XML) | lateral ligament flavum thickness (XML)
LLSL ( in XML ) (3)
» low-level sick leave (XML) | long-lived small lymphocytes (XML)
LLWR ( in XML ) (3)
» least limiting water range (XML)
LLC cells ( in XML ) (3)
» Lewis lung cancer cells (XML) | Lewis lung carcinoma cells (XML)
LLOAD ( in XML ) (3)
» lower-limb occlusive arterial disease (XML)
LLDDs ( in XML ) (3)
» lethal lung developmental disorders (XML)
LLGP-EITB ( in XML ) (3)
» lentil lectin-bound glycoprotein enzyme-linked immunoelectrotransfer blot assay (XML)
LLE/AD ( in XML ) (3)
» limited life expectancy and/or advanced dementia (XML) | LLE and/or advanced dementia (XML)
LLBP ( in XML ) (3)
» local line binary pattern (XML) | LBP divided into groups reporting low (XML)
LL-GBP ( in XML ) (3)
» long-limb GBP (XML) | long-limb bypass (XML) | long-limb gastric bypass (XML)
LLOI ( in XML ) (3)
» lower leg overuse injury (XML) | Lower limit of identification (XML)
LLBD ( in XML ) (3)
» late-life bipolar disorder (XML) | Live Life Better Derbyshire (XML)
LL-VMB ( in XML ) (3)
» low-Lactobacillus vaginal microbiota (XML)
LLNL's ( in XML ) (3)
» Lawrence Livermore National Laboratory's (XML)
LLAMS ( in XML ) (3)
» lumen apposing metal stent (XML) | Lower Limb Extremity Amputee Measurement Scale (XML) | Lower Limb Amputee Measurement Scale (XML)
LLE ratio ( in XML ) (3)
» lung-to-liver elastography ratio (XML)
LLGC ( in XML ) (3)
» Lymphoepithelioma-like gastric carcinoma (XML) | Longitudinal latent growth curve (XML) | local and global consistency method (XML)
LLDT ( in XML ) (3)
» lipid-lowering drug treatment (XML) | lateralized lexical decision task (XML)
LL-BFRT ( in XML ) (3)
» low-load blood flow restriction training (XML) | Low-load blood flow restriction strength training (XML)
LLDB ( in XML ) (3)
» Large linked databases (XML) | Learning-based Local Difference Binary (XML)
LLLM ( in XML ) (3)
» lower limb lean-mass (XML)
l-LTP ( in XML ) (3)
» Late long-term potentiation (XML) | late-LTP (XML)
LLSE ( in XML ) (3)
» linear least square error (XML) | liquid-liquid solvent extraction (XML) | left side-lying sling exercise (XML)
LLGPs ( in XML ) (3)
» lentil lectin-purified glycoproteins (XML)
L-LTD ( in XML ) (3)
» late-phase long-term synaptic depression (XML) | Late-phase long-term depression (XML) | late-LTD (XML)
LLC NPs ( in XML ) (3)
» lyotropic liquid crystal nanoparticle (XML) | LLC nanoparticles (XML)
LLPD ( in XML ) (3)
» late luteal phase dysphoric disorder (XML) | late-life psychotic depression (XML)
LLPN ( in XML ) (3)
» laser-assisted LPN (XML) | laser-assisted laparoscopic partial nephrectomy technique (XML)
LLCB ( in XML ) (3)
» linear latent causal Bayes (XML) | longest side-length of a circumscribed box (XML)
LLNWP ( in XML ) (3)
» Lotus Lake National Wetland Park (XML) | low-latitude northwestern Pacific (XML)
LLAP ( in XML ) (3)
» Legionella-like amoebal pathogen (XML) | lower limb adjusted perimeter (XML)
LLf ( in XML ) (3)
» low-dose Lf (XML) | low-dose Lf treatment group (XML)
LLACs ( in XML ) (3)
» lupus-like anticoagulants (XML) | lower leg arterial calcifications (XML)
LLIL ( in XML ) (3)
» low-level infrared laser (XML) | lateral incisor length (XML)
LLPSs ( in XML ) (3)
» liquid-liquid phase separations (XML)
LL7 ( in XML ) (3)
» LUX-Lung 7 (XML) | Lactococcus lactis at 107 CFU/g (XML)
LLCCs ( in XML ) (3)
» long LCCs (XML) | Lewis lung carcinoma cells (XML) | Long linear carbon chains (XML)
LLSelf ( in XML ) (3)
» Lake Louise AMS Self-report Score (XML)
LLPV ( in XML ) (3)
» left lower pulmonary vein (XML)
LLIVCT ( in XML ) (3)
» ligand-to-ligand intervalence charge transfer (XML)
LLNS ( in XML ) (3)
» Landau-Lifshitz-Navier-Stokes (XML) | low-level neurological state (XML)
L-loop ( in XML ) (3)
» larger loop (XML) | left-sided morphological right ventricle and right-sided morphological left ventricle (XML) | luminal loop (XML)
LLDME ( in XML ) (3)
» Locally Linear Diffeomorphic Metric Embedding (XML)
LLHM ( in XML ) (3)
» Laparoscopic limited Heller myotomy (XML) | Local Linear Histogram Matching (XML) | Lewis lung high metastatic (XML)
LLHS ( in XML ) (3)
» leaf litter-derived humic substance (XML) | low light-human segmentation (XML)
LLPv2 ( in XML ) (3)
» Liverpool Lung Project-v2 (XML) | Liverpool Lung Project version 2 (XML)
LLLE ( in XML ) (3)
» lower limb lymphedema (XML) | Liquid-liquid-liquid equilibria (XML) | lower-limb lymphatic edema (XML)
LLC's ( in XML ) (3)
» long-lived coherences (XML)
L-line ( in XML ) (3)
» line selected against backfat thickness (XML) | low female reproductive investment (XML) | lethal-line (XML)
LLDVT ( in XML ) (3)
» lower limb deep vein thrombosis (XML)
LL-PI ( in XML ) (3)
» lumbar lordosis-pelvic incidence (XML) | LL-pelvic incidence (XML)
LLTQ ( in XML ) (3)
» Lower Limb Tasks Questionnaire (XML)
LLv ( in XML ) (3)
» lemnisci lateralis, pars ventralis (XML) | lateral lemniscus, pars ventralis (XML)
lls ( in XML ) (3)
» listeriolysin S (XML) | local least squares (XML)
LL-CL ( in XML ) (3)
» low-level chemiluminescence (XML)
LL-KF140 ( in XML ) (3)
» Lactococcus lactis KF140 (XML)
LLSME ( in XML ) (3)
» liquid-liquid-solid microextraction (XML)
LLUs ( in XML ) (3)
» lower-limb ulcers (XML)
LLVL ( in XML ) (3)
» low-level viral load (XML) | Low-level visible light (XML)
LLIM ( in XML ) (3)
» liquid/liquid interface microsensor (XML) | Luminescence lifetime imaging (XML) | Limited Literacy Impact Measure (XML)
LLm ( in XML ) (3)
» lumbar lordosis (XML) | lumbar lordosis measured (XML)
LLGL ( in XML ) (3)
» liquid light-guide lens (XML) | Llglh gene (XML)
L-LEP ( in XML ) (3)
» Lepromatous leprosy (XML) | limited English proficiency (XML)
LLTTF ( in XML ) (3)
» Living Life to the Full (XML) | Life to the Full (XML)
LLRF ( in XML ) (3)
» low-level radio frequency (XML) | Low Level RF (XML)
LLMZ ( in XML ) (3)
» leg lean mass z-score (XML)
LLFDI-FC ( in XML ) (3)
» Late-Life Function and Disability Index: function component (XML) | LLFDI-Function Component (XML)
LLNC ( in XML ) (3)
» landfill leachate nanofiltration concentrate (XML)
LLIEP ( in XML ) (3)
» low-lying-implantation ectopic pregnancy (XML)
LL-OEW ( in XML ) (2)
» light line OEW (XML) | Light Line Optoelectrowetting (XML)
LLCN ( in XML ) (2)
» lncRNAlncRNA co-expression network (XML) | lyotropic liquid crystalline nanosystems (XML)
LLSTs ( in XML ) (2)
» large lateral spreading tumors (XML) | limitations on life support techniques (XML)
LLLND ( in XML ) (2)
» lateral lymph node dissection for rectal cancer group (XML) | laparoscopic lateral lymph node dissection (XML)
LLT-ESPs ( in XML ) (2)
» low-low temperature electrostatic precipitators (XML) | low-low-temperature ESPs (XML)
LLSD ( in XML ) (2)
» lower limb sensory deficits (XML) | lymphadenoma lacking sebaceous differentiation (XML)
LLC-GFP ( in XML ) (2)
» Lewis-lung carcinoma cells labeled with GFP (XML) | lung carcinoma cells constitutively expressing GFP (XML)
L-LDL ( in XML ) (2)
» low LDL-C (XML) | large low-density lipoprotein (XML)
LLD-S ( in XML ) (2)
» LLD patients with suicidal ideation (XML)
L. lactis subsp. lactis ( in XML ) (2)
» Lactococcus lactis subsp. lactis (XML)
LLTIs ( in XML ) (2)
» life- and limb-threatening injuries (XML)
LLIRCT ( in XML ) (2)
» liquid-liquid interface recrystallization technique (XML)
LLDNs ( in XML ) (2)
» laparoscopic living-donor nephrectomies (XML) | lower-limb drainage nodes (XML)
llb ( in XML ) (2)
» lethal left of bithorax gene (XML) | lullaby (XML)
LLhP ( in XML ) (2)
» LacI DNA-binding domain/linker and the PurR regulatory domain (XML) | LacI/GalR homologues, we have created a chimeric protein (XML)
LLPAD ( in XML ) (2)
» lower limb peripheral arterial disease (XML)
LLLal ( in XML ) (2)
» Leu-Leu-Leu-aldehyde (XML) | Leu-Leu-Leu-al (XML)
LL-BCVA ( in XML ) (2)
» low-luminance BCVA (XML)
L-LMS ( in XML ) (2)
» lipoleiomyosarcomas (XML)
LLHV ( in XML ) (2)
» low-load high-velocity (XML)
LLR-Ro ( in XML ) (2)
» lower limb rehabilitation robot (XML)
L,L-DAP ( in XML ) (2)
» L,L-diaminopimelate (XML) | L,L-diaminopimelic acid (XML)
LLGL1 ( in XML ) (2)
» lethal giant larvae homolog 1 (XML) | Lgl, Lgl1 (XML)
LLON ( in XML ) (2)
» leprosy late-onset neuropathy (XML)
LLDL ( in XML ) (2)
» low-level diode laser (XML)
l-lat ( in XML ) (2)
» left-lateral position (XML)
llmJOA ( in XML ) (2)
» lower limb mJOA (XML)
LLVs ( in XML ) (2)
» light levels variations (XML) | lymphoid leukosis viruses (XML)
LLPF ( in XML ) (2)
» longissimus lumborum peak force (XML) | lateral leg perforator flap (XML)
LLINS ( in XML ) (2)
» long-lasting insecticidal nets (XML)
L-LAMP ( in XML ) (2)
» lyophilized loop mediated isothermal amplification (XML)
llz ( in XML ) (2)
» lounge lizard (XML)
LLD-NS ( in XML ) (2)
» LLD patients without suicidal ideation (XML)
LLVEF ( in XML ) (2)
» low left ventricular ejection fraction (XML)
LLLL ( in XML ) (2)
» late-life language learning (XML) | Low-level laser-assisted liposuction (XML)
LLSAWs ( in XML ) (2)
» longitudinal leaky SAWs (XML)
L-LDHs ( in XML ) (2)
» l-lactate dehydrogenases (XML)
LL-14 ( in XML ) (2)
» 14-residue-long lysine-rich cationic antimicrobial peptide (XML) | LKWLKKLLKWLKKL (XML)
LLUSD ( in XML ) (2)
» Loma Linda University School of Dentistry (XML)
LLDPEs ( in XML ) (2)
» linear low-density PEs (XML) | linear low-density polyethylenes (XML)
LLFD ( in XML ) (2)
» life-limiting fetal diagnosis (XML) | Late-Life Function and Disability (XML)
LLEBV ( in XML ) (2)
» Lleida bat lyssavirus (XML) | lyssavirus, Lleida bat lyssavirus (XML)
LLRRs ( in XML ) (2)
» Lower limb rehabilitation robots (XML) | long latency reflex responses (XML)
LL-TFE ( in XML ) (2)
» Look-Locker turbo-field-echo (XML)
l,l-DAP ( in XML ) (2)
» l,l-diaminopimelic acid (XML) | l,l-diaminopimelate (XML)
L. LPMC ( in XML ) (2)
» left lateral premotor cortex (XML)
l,l-SDAP ( in XML ) (2)
» N-succinyl-l,l-diaminopimelic acid (XML)
Llgl2 ( in XML ) (2)
» lethal giant larvae 2 (XML) | LLGL Scribble cell polarity complex component 2 (XML)
LLEP ( in XML ) (2)
» lower limb extensor power (XML) | long-latency evoked potentials (XML)
LLTV ( in XML ) (2)
» Lipoblastoma-like tumor of the vulva (XML) | loose-leaf tobacco vaporizer (XML)
LLCGs ( in XML ) (2)
» lower lateral cartilaginous grafts (XML) | lower-limb compression garments (XML)
LLCV ( in XML ) (2)
» lilac leaf chlorosis virus (XML)
L-LecRKs ( in XML ) (2)
» L-type LecRKs (XML) | lectin receptor-like kinases (XML)
Lls1 ( in XML ) (2)
» lethal leaf spot 1 (XML)
LLDAV ( in XML ) (2)
» lamium leaf distortion-associated virus (XML)
LLOQ QC ( in XML ) (2)
» limit of quantitation quality control (XML)
LLMOs ( in XML ) (2)
» layered lithium transition metal oxides (XML) | Layered, Li-rich Mn-based oxides (XML)
LLSSE ( in XML ) (2)
» Life Study of Social Exchanges (XML)
LLE/LTP ( in XML ) (2)
» liquid-liquid extraction with a low-temperature partition (XML)
LLD3 ( in XML ) (2)
» low ligation of the IMA with D3 dissection (XML) | ligation D3 lymph node dissection (XML)
LLEE ( in XML ) (2)
» low-level exercise echocardiography (XML) | lotus leaf ethanol extract (XML)
LLSB ( in XML ) (2)
» long-lasting slow bursting (XML) | locking-loop suture bridge (XML)
LLC-CM ( in XML ) (2)
» LLC-LN7-conditioned medium (XML)
lLOC ( in XML ) (2)
» lateral occipital cortex (XML)
LLPU ( in XML ) (2)
» liquefied lignin-based polyurethane (XML) | lower-limb prosthesis user (XML)
LLET ( in XML ) (2)
» ligand-to-ligand ET (XML) | low linear energy transfer (XML)
LL-CNN ( in XML ) (2)
» lifelong learning-based convolutional neural network (XML) | life-long learning segmentation CNN (XML)
LLL Biostimulation ( in XML ) (2)
» low level laser therapy biostimulation (XML)
L,L-EC ( in XML ) (2)
» L,L-ethylenedicysteine (XML)
LLFPs ( in XML ) (2)
» long-lived fission products (XML)
LLTG ( in XML ) (2)
» Lipid-lowering therapy Group (XML) | low load training group (XML)
L-LNR ( in XML ) (2)
» low-LNR (XML)
L-LYC ( in XML ) (2)
» lycopene liposomes (XML) | lycopene-loaded liposomes (XML)
LLDLT ( in XML ) (2)
» liver living donor liver transplantation (XML) | low-level diode laser therapy (XML)
LLQC ( in XML ) (2)
» lower limit of quantification (XML)
LL35 ( in XML ) (2)
» Leech lectin 35 (XML) | lead length at 35 days (XML)
LLML ( in XML ) (2)
» long lasting microbial larvicides (XML)
lls1 ( in XML ) (2)
» lethal leaf spot1 (XML) | long life span 1 (XML)
LLFV ( in XML ) (2)
» lunate-lunate facet variance (XML) | Local low-frequency vibration (XML)
LLPS-PIESA ( in XML ) (2)
» liquid-liquid phase-separation-driven polymerization-induced electrostatic self-assembly (XML)
LLAO ( in XML ) (2)
» lower limb arterial occlusions (XML) | lysosome-like acidic organelles (XML)
LLC-MDR1 ( in XML ) (2)
» LLC-PK1, and its transformant cells expressing human P-glycoprotein (XML) | Laboratories Cell Porcine Kidney 1 cells overexpressing MDR1 (XML)
LLRa ( in XML ) (2)
» long-latency response amplitude (XML) | LLR amplitude (XML)
llf ( in XML ) (2)
» lateral funiculi (XML) | large leaf (XML)
LLWS ( in XML ) (2)
» Little League World Series (XML) | Live Long Walk Strong (XML)
LLLvel ( in XML ) (2)
» lower leg length velocity (XML) | LLL velocity (XML)
LLOC ( in XML ) (2)
» left occipital condyle (XML) | lowest level of consciousness (XML)
L-LDI ( in XML ) (2)
» L-Lysine ethyl ester diisocyanate (XML)
lli ( in XML ) (2)
» leafless inflorescence (XML)
LLVNS ( in XML ) (2)
» level left vagus nerve stimulation (XML) | low-level vagosympathetic nerve stimulation (XML)
LLVSs ( in XML ) (2)
» long-lasting voltage shifts (XML) | lower lobar vessels of the spleen (XML)
LLRY ( in XML ) (2)
» long loop Roux-en-Y gastrojejunostomy (XML) | long-limb Roux-en-Y (XML)
LLFQ ( in XML ) (2)
» Lower Limb Function Questionnaire (XML)
LL-DAP ( in XML ) (2)
» LL-diaminopimelic acid (XML) | large LL-diaminopimelic acid (XML)
L. longipalpis ( in XML ) (2)
» Lutzomyia longipalpis (XML)
LLATSA ( in XML ) (2)
» left anterior transperitoneal submesocolic adrenalectomy (XML)
LLMM ( in XML ) (2)
» lower limb muscle mass (XML)
LLVB ( in XML ) (2)
» large left ventricular branch (XML) | low lung volume breathing (XML)
LLECs ( in XML ) (2)
» long-lived effector cells (XML) | Leptomeningeal lymphatic endothelial cells (XML)
l-LTM ( in XML ) (2)
» late long-term memory (XML) | late long-term (XML)
LLAMSS ( in XML ) (2)
» Lake Louise Acute Mountain Sickness Score (XML) | Lake Louise AMS score (XML)
LLSLHFY14 ( in XML ) (2)
» Lactococcus lactis subsp. lactis HFY14 (XML)
LLUNA ( in XML ) (2)
» Literate Language Use in Narrative Assessment (XML)
L-L-L ( in XML ) (2)
» low walkability/transit/recreation (XML)
LLRNN ( in XML ) (2)
» low-delay lightweight recurrent neural network (XML)
LL-III ( in XML ) (2)
» Lasioglossin-III (XML)
LLBWP ( in XML ) (2)
» LLBWP compared to HLBWP (XML) | low LBWP (XML)
LLYHZ ( in XML ) (2)
» Long-Liang-You-Hua-Zhan (XML) | Longliangyou Huazhan (XML)
LLMA ( in XML ) (2)
» lower limb mechanical axis (XML)
LLAN ( in XML ) (2)
» late left anterior negativity (XML)
LL37 ( in XML ) (2)
» LL37-conjugated gold nanoparticles, LL37-Au NPs (XML) | cathelicidin-LL37 (XML)
L-Leu-L-Pro ( in XML ) (2)
» levels found in dough prior to baking. cis-Cyclo (XML) | liquid chromatography (HPLC) was performed to explore cyclo (XML)
LLBI ( in XML ) (2)
» lower limb burn injury (XML)
LLID ( in XML ) (2)
» LocusLink ID (XML)
LLL-STS ( in XML ) (2)
» lower limb loading during sit-to-stand (XML)
LLS 2 and 3 ( in XML ) (2)
» laparoscopic liver sectionectomy 2 and 3 (XML)
LLMPs ( in XML ) (2)
» local labour market programmes (XML) | late-life mortality plateaus (XML)
LLIG ( in XML ) (2)
» low-level intervention group (XML) | lower lumbar instability group (XML)
LLGCV ( in XML ) (2)
» L-Val-L-Val-GCV (XML)
LLETZ-cone ( in XML ) (2)
» large loop excision of transformation zone, as a cone procedure (XML) | Large Loop Excision of the Transformation Zone (XML)
LLSPD-Net ( in XML ) (2)
» Low-Light Sparse Polarization Demosaicing Network (XML)
LL-CNR ( in XML ) (2)
» lesion-to-liver contrast-to-noise ratio (XML)
LLDR ( in XML ) (2)
» leg-length discrepancy ratio (XML) | long-lasting depression of reflexes (XML)
LLBF ( in XML ) (2)
» Layered Lightweight Blockchain Framework (XML) | left leg blood flow (XML)
LLVP ( in XML ) (2)
» left lateral ventricular preexcitation (XML) | lower limb vascular pain (XML)
L-LSGP ( in XML ) (2)
» large sialoglycoprotein of human lymphocytes (XML)
l loop ( in XML ) (2)
» left-hand topology (XML)
LLK48 ( in XML ) (2)
» Lactococcus lactis KUST48 (XML) | L. lactis KUST48 (XML)
LLaVA ( in XML ) (2)
» Large Language-and-Vision Assistant (XML)
LL-HL ( in XML ) (2)
» low-light-to-high-light (XML) | LL plants were transferred to a high-sunlight environment (XML)
LLVC ( in XML ) (2)
» lateral lingual vascular canal (XML) | lymphatic limbal vascular complex (XML)
l-LAC ( in XML ) (2)
» l-lactate concentrations (XML)
LLPHF ( in XML ) (2)
» low-level private health facilities (XML)
LLCBF ( in XML ) (2)
» lower limit of CBF autoregulation (XML) | lower limit of cerebral blood flow autoregulation (XML)
l-LSM ( in XML ) (2)
» l-lysine semi-maleate (XML)
L-LCR ( in XML ) (2)
» L-lactate ferricytochrome c oxidoreductase (XML)
LLROM ( in XML ) (2)
» Lower limb range of motion (XML)
LLNle ( in XML ) (2)
» leucine-leucin-norleucinal (XML) | Benzyloxicarbonyl-Leu-Leu-Nle-CHO (XML)
LLAGN ( in XML ) (2)
» low-luminosity active galactic nucleus (XML)
LLTSA ( in XML ) (2)
» liner local tangent space arrangement (XML)
LLAA ( in XML ) (2)
» Low-liquid aqueous ammonia (XML) | LAA ligation (XML)
LLSVP ( in XML ) (2)
» large low-shear-velocity province (XML)
LL-RT ( in XML ) (2)
» low-load resistance exercise (XML) | LL-BFR-RT (XML)
L line ( in XML ) (2)
» low line (XML) | low humoral immune reactivity (XML)
LLaMA2 ( in XML ) (2)
» LLM Meta AI 2 (XML) | Language Models by Meta AI 2 (XML)
LL-MACE ( in XML ) (2)
» low-load MACE (XML) | low-load metal-assisted catalytic etching (XML)
L-lysine-HCl ( in XML ) (2)
» levels mentioned could be achieved by lysine supplements (XML) | L-lysine hydrochloride (XML)
LLFFM ( in XML ) (2)
» lower limb fat-free (XML) | lower-limb FFM (XML)
LLPHFs ( in XML ) (2)
» low-level private health facilities (XML)
l,l-TMAP ( in XML ) (2)
» N,N,N-trimethyl-l-alanine-l-proline betaine (XML)
Llo ( in XML ) (2)
» L. longbeachae, endogenous SidC (XML) | Legionella longbeachae (XML)
L-LUS ( in XML ) (2)
» Laparoscopy with laparoscopic ultrasonography (XML)
lld-ACV ( in XML ) (2)
» delta-l-alpha-aminoadipoyl-l-cysteinyl-d-valine (XML)
LLGHGs ( in XML ) (2)
» long-lived greenhouse gases (XML)
LL-SEP ( in XML ) (2)
» long latency somatosensory evoked potentials (XML)
LLHF ( in XML ) (2)
» lowest lean/highest fat (XML) | lower level health facilities (XML)
LLMUPR ( in XML ) (2)
» low-level mupirocin-resistant (XML)
LlPDS ( in XML ) (2)
» L. leichtlinii phytoene desaturase gene (XML)
L. lactis NZ9000 ( in XML ) (2)
» Lactococcus lactis NZ9000 (XML)
LLVY ( in XML ) (2)
» N-succinyl-Leu-Leu-Val-Tyr 7-amino-4-methylcoumarin (XML) | Suc-Leu-Leu-Val-Tyr-AMC (XML)
L-LS ( in XML ) (2)
» low-dose laser treatment group (XML) | LyP-1-conjugated liposomes (XML)
LLAMAS ( in XML ) (2)
» lickety-split ligand-affinity-based molecular angling system (XML) | low-latency adaptive optical mirror system (XML)
LLSRS ( in XML ) (2)
» Lake Louise self-report score (XML)
LL-HN ( in XML ) (2)
» low-light and high-nitrogen (XML)
L-LBM ( in XML ) (2)
» limb lean body mass (XML)
LLT50 ( in XML ) (2)
» lethal temperatures at 50% mortality (XML) | lethal temperature to kill 50% of the population (XML)
LLAPC ( in XML ) (2)
» log-linear age-period-cohort (XML)
LLsME ( in XML ) (2)
» liquid-liquid semimicroextraction (XML)
LLCMs ( in XML ) (2)
» Luminescent liquid crystal materials (XML) | lyotropic liquid crystalline mesophases (XML)
LLNI ( in XML ) (2)
» low-level neuroinflammation (XML)
LLD-ACV ( in XML ) (2)
» delta-L-alpha-aminoadipyl-L-cysteinyl-D-valine (XML)
LLGI ( in XML ) (2)
» log-likelihood gain on intensity (XML) | low level gamma irradiation (XML)
LL-Gp ( in XML ) (2)
» lentil-lectin purified glycoprotein (XML) | lentil-lectin semi-purified glycoprotein extract of T. solium (XML)
LLDK ( in XML ) (2)
» LLDK group (XML) | lower lumbar degenerative kyphosis (XML)
LLMIs ( in XML ) (2)
» lower limit of measuring intervals (XML) | lower limb muscle injuries (XML)
LLP1 ( in XML ) (2)
» LECTIN-LIKE PROTEIN1 (XML)
LLREs ( in XML ) (2)
» low-level radioactive effluents (XML) | lower limb rehabilitation exoskeletons (XML)
LLMV ( in XML ) (2)
» lowest levels of method validation (XML) | lower limb muscle volume (XML)
LLVPs ( in XML ) (2)
» large low-velocity provinces (XML)
LLPE ( in XML ) (2)
» left-sided LPE (XML) | lifelong PE (XML)
Llo PRP ( in XML ) (2)
» leukocyte-low platelet rich plasma (XML) | low-leukocyte PRP (XML)
LL-MN ( in XML ) (2)
» lumber longissimus muscle (XML) | lupus-like membranous nephropathy (XML)
LLNB ( in XML ) (2)
» laparoscopic lymph node biopsy (XML) | low level narrow band (XML)
LLP-I ( in XML ) (2)
» lentiviral lytic peptide I (XML)
llmRNA ( in XML ) (2)
» leaderless mRNA (XML)
LL-FAS ( in XML ) (2)
» Lower Limb-Function Assessment Scale (XML)
LLCRs ( in XML ) (2)
» lesion-to-liver contrast ratios (XML) | leadership line care rounds (XML)
LLNMs ( in XML ) (2)
» lateral lymph node metastases (XML) | Low-solubility, low-permeability natural medicines (XML)
LLC-GEN ( in XML ) (2)
» lyotropic liquid crystal genistein-based formulation (XML)
LLDKT ( in XML ) (2)
» living donor kidney transplantation (XML)
LLHFs ( in XML ) (2)
» lower level health facilities (XML)
LL-BFRE ( in XML ) (2)
» low-load blood-flow-restriction exercise (XML)
LLSW ( in XML ) (2)
» longitudinal leaky surface waves (XML)
LLnV ( in XML ) (2)
» carbobenzoxy-L-leucyl-L-leucyl-L-norvalinal (XML)
Lla-Met ( in XML ) (2)
» linolenic acid-metronidazole (XML) | compound-linolenic acid-metronidazole (XML)
LLys ( in XML ) (2)
» lipoyllysine (XML)
LLMO ( in XML ) (2)
» layered lithium-rich manganese oxide-based (XML) | I-Low lean mass and Osteoporosis (XML)
LLac ( in XML ) (2)
» Leuconostoc lactis (XML) | low light-acclimated (XML)
LLFI-10 ( in XML ) (2)
» Lower Limb Functional Index-10 (XML)
LLLT.G ( in XML ) (2)
» LLLT group (XML)
LLTO/C ( in XML ) (2)
» lithium lanthanum titanate/carbon (XML) | lithium lanthanum titanium oxide/carbon (XML)
A Search Service for Abbreviation / Long Form